Align ABC transporter for D-Alanine, permease component 1 (characterized)
to candidate GFF2619 PGA1_c26600 amino acid ABC transporter, permease protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_5404 (365 letters) >FitnessBrowser__Phaeo:GFF2619 Length = 273 Score = 109 bits (272), Expect = 1e-28 Identities = 72/221 (32%), Positives = 112/221 (50%), Gaps = 22/221 (9%) Query: 157 GLMLTLVIATVGIVGALPLGIVLALGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSSVM 216 G+ LT+ + + A LG+ LAL S IR +IE RG+P+I +L + + Sbjct: 52 GVQLTIFVTLISFFLASLLGLGLALAAGSRWLVIRQGARFYIEVVRGIPIIVLLLYVAFV 111 Query: 217 LPLFLPE---------------GMNFDKLLRALIGVILFQSAYIAEVVRGGLQAIPKGQY 261 L L E NF L RA+I +++ SA+I+EV R GLQ++ +GQ Sbjct: 112 LAPALVELRNWLGDHIGLDPIRTRNFPLLWRAIIALMIAYSAFISEVFRAGLQSVDEGQI 171 Query: 262 EAAAAMGLGYWRSMGLVILPQALKLVIPGIVNTFIALFKDTSLVIIIGLFDLLNSVKQAA 321 EAA ++GL W ++ PQA++ ++P + N F+AL KD+SLV ++G+ D+ K A Sbjct: 172 EAAKSLGLSRWHRFRFIVFPQAIRTILPPLGNDFVALVKDSSLVSVLGVADVTQLGKLTA 231 Query: 322 ADPKWLGMATEGYVFAALVFWIFCFGMS----RYSMHLERK 358 E Y AL++ G+S R+ HL R+ Sbjct: 232 VGN---FRYFETYNVVALIYLTLTIGLSLLLRRFEKHLRRR 269 Lambda K H 0.330 0.144 0.469 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 304 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 273 Length adjustment: 27 Effective length of query: 338 Effective length of database: 246 Effective search space: 83148 Effective search space used: 83148 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory