Align D-lactate transporter, ATP-binding component (characterized)
to candidate GFF1631 PGA1_c16530 putative branched-chain amino acid transporter, ATP-binding protein
Query= reanno::Phaeo:GFF1248 (251 letters) >FitnessBrowser__Phaeo:GFF1631 Length = 256 Score = 172 bits (437), Expect = 5e-48 Identities = 93/247 (37%), Positives = 141/247 (57%), Gaps = 4/247 (1%) Query: 3 ILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMF 62 +LEV+++ K FG LQA +++L +R +HA+IGPNGAGKSTL+ + G+L PD+GSV Sbjct: 10 VLEVRDLSKSFGALQASKNISLDLRAGEIHALIGPNGAGKSTLIKQISGELRPDSGSVSL 69 Query: 63 DGKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAISAVSGQ 122 G V + +MG+ R FQ + D +VL+N ++ R G F + V Sbjct: 70 LGHPVDDLSRVARARMGLGRTFQISALAMDFTVLQNAVLGALGARGGVFRF--LGNVMRD 127 Query: 123 RDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGMARA 182 + ++ +AEH LE + + A +S G +R+LE+ + L+ +PRL L+DEP AG+ Sbjct: 128 KALVAQAEHALERVGLLSDAKRRTADLSHGQRRQLEVAVALTLQPRLFLMDEPMAGLGAG 187 Query: 183 DTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKGNPKV 242 + L ++ E I ++EHDM VF+LADRI+VL G + I+ N +V Sbjct: 188 GSQALTGFLNTLRHE--APILLVEHDMDAVFALADRISVLVYGEVIATGTTDEIRNNAEV 245 Query: 243 REAYLGE 249 R AYLGE Sbjct: 246 RRAYLGE 252 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 256 Length adjustment: 24 Effective length of query: 227 Effective length of database: 232 Effective search space: 52664 Effective search space used: 52664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory