GapMind for catabolism of small carbon sources

 

Aligments for a candidate for SMc02871 in Phaeobacter inhibens BS107

Align N-Acetyl-D-glucosamine ABC transport system, permease component 2 (characterized)
to candidate GFF725 PGA1_c07400 binding protein dependent transport system permease

Query= reanno::Phaeo:GFF2752
         (280 letters)



>lcl|FitnessBrowser__Phaeo:GFF725 PGA1_c07400 binding protein
           dependent transport system permease
          Length = 282

 Score =  132 bits (333), Expect = 6e-36
 Identities = 80/265 (30%), Positives = 138/265 (52%), Gaps = 3/265 (1%)

Query: 18  ALITYTLIA-LFPVFVILVNSFKTRKAIFRDPL-GLPTSDTFSLVGYQTVLKQGDFFLYF 75
           AL+   L+  L P+  + + S K           G+P+S    L  Y  V    D   Y 
Sbjct: 19  ALVPAALVMWLLPLIAVAIFSIKPEADFTTGNYWGVPSSFE-GLSNYGRVFFGSDMPRYL 77

Query: 76  QNSMIVTVVSLALVLLFGAMAAFALAEYRFKGNMLLGLYLALGIMIPIRIGTVAILELMV 135
            NS+++TV ++   +    M  FAL  Y+F+GN+LL      G  +P +I  V + +L +
Sbjct: 78  LNSVLITVPTVIGAVALSCMTGFALGVYKFRGNLLLFFMFVAGNFVPFQILMVPVRDLTL 137

Query: 136 DTGLVNTLTALILVYTAQGLPLAVFILSEFMKQVSDDLKNAGRIDGLSEYTIFFRLVLPL 195
           D GL NT T L+L + A         +  F++ +  +L  A R++G++E+ IF+ +VLPL
Sbjct: 138 DMGLYNTKTGLVLFHIAFQTGFCTLFMRNFIRALPFELIEAARVEGVAEWRIFWFVVLPL 197

Query: 196 VRPAMATVAVFNMIPIWNDLWFPLILAPAEETKTLTLGSQVFIGQFVTDWNAVLSALSMA 255
           ++PA+A ++V     IWND ++ ++L    E++ +T G   F  Q+   ++ + +   +A
Sbjct: 198 MKPAIAALSVLIFTFIWNDYFWAVVLTQGAESQPVTAGITSFNAQYRAAYHLMSAGSIVA 257

Query: 256 ILPVMVLYVIFSRQLIRGITSGAVK 280
            LP + ++ +  R  I G+T GAVK
Sbjct: 258 ALPPVAMFFLMQRHFIAGLTLGAVK 282


Lambda     K      H
   0.330    0.143    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 214
Number of extensions: 12
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 280
Length of database: 282
Length adjustment: 26
Effective length of query: 254
Effective length of database: 256
Effective search space:    65024
Effective search space used:    65024
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 47 (22.7 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory