GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ngcF in Phaeobacter inhibens BS107

Align NgcF, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized)
to candidate GFF726 PGA1_c07410 binding protein dependent transport system permease

Query= TCDB::Q8RJU9
         (308 letters)



>lcl|FitnessBrowser__Phaeo:GFF726 PGA1_c07410 binding protein
           dependent transport system permease
          Length = 315

 Score =  135 bits (341), Expect = 1e-36
 Identities = 92/286 (32%), Positives = 149/286 (52%), Gaps = 22/286 (7%)

Query: 12  FLAVPLGLYALLVVWPFIQSIYYSFTDWTGLSPDFKTVGFDNYERMLDDDIFWKSLQHSL 71
           FLA  +  +   V++P +QS   SF  W GL  D + +G +NY  ++DD  F  SL ++L
Sbjct: 36  FLAPGVIFFLFYVIFPILQSFNLSFYRWDGLG-DPQFIGMENYRELMDDRAFEVSLWNNL 94

Query: 72  LFALLLPVVTIGLALFFAFMINVGGRRRRGGPVITGVRGSGFYKIVYFFPQVLSIAIVAL 131
            + LLL ++ I   LF A  +N           +TG+R    YK ++FFP V+S  +V L
Sbjct: 95  KW-LLLYLLAIPAGLFIALFLN---------QTVTGIR---LYKSLFFFPFVISQVVVGL 141

Query: 132 LFAFAYNPDSGAINSLLRGIGLGDVQPVWLGDPDLALWCVMAVIVWSTVGFFVVLFSAGM 191
           +F++ Y+P  G +N +L  +GLG +    LGDP L  + ++   +W    + ++L+  G+
Sbjct: 142 VFSWFYDPTFGLLNQVLAWVGLGPINV--LGDPTLVTYGIIIAGLWPQTAYCMILYLTGL 199

Query: 192 ASIPADIYEAALLDGANRVTTFFRITLPLLWDTVQSGWVYMGILALGAESFAVVHIMTTG 251
            ++  +  EAA LDGA      + + +P L       +V   I AL   SF ++ IMT  
Sbjct: 200 NAVDPEQVEAARLDGAKGAKMLWYVIIPQLRPATFVAFVVTIIGAL--RSFDLISIMTN- 256

Query: 252 PGGPDYSTTVMVLYVYQKAFRD--GQAAYATTIGVALLIVTLAFAA 295
            GGP  S+ V+  Y+++KA  +   +  Y   I V L ++ L F A
Sbjct: 257 -GGPFGSSRVLSFYMFEKALSEYGFRMGYGAAIAVVLFLIMLCFIA 301


Lambda     K      H
   0.330    0.145    0.458 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 295
Number of extensions: 15
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 308
Length of database: 315
Length adjustment: 27
Effective length of query: 281
Effective length of database: 288
Effective search space:    80928
Effective search space used:    80928
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory