GapMind for catabolism of small carbon sources

 

Aligments for a candidate for xacF in Phaeobacter inhibens BS107

Align Ketoglutarate semialdehyde dehydrogenase (EC 1.2.1.26) (characterized)
to candidate GFF501 PGA1_c05130 aldehyde dehydrogenase

Query= reanno::Smeli:SM_b20891
         (477 letters)



>lcl|FitnessBrowser__Phaeo:GFF501 PGA1_c05130 aldehyde dehydrogenase
          Length = 476

 Score =  619 bits (1597), Expect = 0.0
 Identities = 310/475 (65%), Positives = 372/475 (78%), Gaps = 2/475 (0%)

Query: 4   HQNLIAGEWVGG-DGVANINPSNTDDVVGEYARASAEDAKAAIAAAKAAFPAWSRSGILE 62
           ++NLIAG+W       ANINPS+T DV+G  A + AED + AIAAA+ A P W+ S   +
Sbjct: 3   YKNLIAGDWSETVAAAANINPSDTQDVLGYAANSPAEDMERAIAAARDAAPGWASSTPQQ 62

Query: 63  RHAILKKTADEILARKDELGRLLSREEGKTLAEGIGETVRAGQIFEFFAGETLRLAGEVV 122
           R  +L     EILARK ELG+LLSREEGKTL EGIGE  RAGQIF+FFAGETLR AGE++
Sbjct: 63  RFDVLDAIGTEILARKAELGKLLSREEGKTLPEGIGEAARAGQIFKFFAGETLRQAGEIL 122

Query: 123 PSVRPGIGVEITREPAGVVGIITPWNFPIAIPAWKLAPALCYGNTIVFKPAELVPGCSWA 182
            SVRPG+GVE+TR P GVVG+ITPWNFPIAIPAWK+APAL YG+ +V KPAEL PGC+ A
Sbjct: 123 GSVRPGVGVEVTRSPVGVVGLITPWNFPIAIPAWKIAPALAYGDAVVLKPAELTPGCAHA 182

Query: 183 IVDILHRAGLPKGVLNLVMGKGSVVGQAMLDSPDVQAITFTGSTATGKRVAVASVEHNRK 242
           + +I++R+GLP+GV N+V G GS VGQ ++ S  V AI+FTGS  TG  +A A     +K
Sbjct: 183 LAEIINRSGLPEGVFNIVFGTGSTVGQTLVQSRHVDAISFTGSVETGSAIAAACGAQRKK 242

Query: 243 YQLEMGGKNPFVVLDDADLSVAVEAAVNSAFFSTGQRCTASSRIIVTEGIHDRFVAAMGE 302
            QLEMGGKNP VVLDDADL  AV+A++N AFFSTGQRCTASSR+IVTEGIHDRFVAA+GE
Sbjct: 243 LQLEMGGKNPMVVLDDADLETAVDASLNGAFFSTGQRCTASSRLIVTEGIHDRFVAALGE 302

Query: 303 RIKGLVVDDALKPGTHIGPVVDQSQLNQDTDYIAIGKQEGAKLAFGGEVISRDTPGFYLQ 362
           R+ GL V +AL   T IGPVVD+ QL +D  Y+ +   EG ++  GG+ + R T GFYL 
Sbjct: 303 RMTGLRVGNALDDSTQIGPVVDERQLEKDLYYLDVAASEGGQV-LGGQTLQRSTKGFYLA 361

Query: 363 PALFTEATNEMRISREEIFGPVAAVIRVKDYDEALAVANDTPFGLSSGIATTSLKHATHF 422
           PAL TE +N+MRI++EE+FGP+A+VIRV DYDEAL VANDTPFGLS+GI T SLK+ATHF
Sbjct: 362 PALVTETSNDMRINQEEVFGPLASVIRVADYDEALVVANDTPFGLSAGICTGSLKYATHF 421

Query: 423 KRNAEAGMVMVNLPTAGVDFHVPFGGRKASSYGPREQGKYAAEFYTNVKTAYTLA 477
           K +AEAGM MVNLPTAGVD+HVPFGG K SS+G REQG +A EFYT VKTAYTLA
Sbjct: 422 KAHAEAGMAMVNLPTAGVDYHVPFGGTKGSSFGAREQGSHAKEFYTKVKTAYTLA 476


Lambda     K      H
   0.317    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 748
Number of extensions: 31
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 477
Length of database: 476
Length adjustment: 33
Effective length of query: 444
Effective length of database: 443
Effective search space:   196692
Effective search space used:   196692
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory