GapMind for catabolism of small carbon sources

 

Aligments for a candidate for xacJ in Phaeobacter inhibens BS107

Align Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale)
to candidate GFF2690 PGA1_c27320 putative sugar ABC transporter, ATP-binding protein

Query= uniprot:D4GP38
         (383 letters)



>lcl|FitnessBrowser__Phaeo:GFF2690 PGA1_c27320 putative sugar ABC
           transporter, ATP-binding protein
          Length = 349

 Score =  303 bits (775), Expect = 6e-87
 Identities = 170/365 (46%), Positives = 228/365 (62%), Gaps = 22/365 (6%)

Query: 1   MGQIQLTDLTKRFGDTVAVDDLSLDIDDEEFLVLVGPSGCGKSTTLRMLAGLETPTSGDI 60
           M QI+L +++KR+G  V VD+  L I D+EFLVL+GPSGCGK+TT+RM+AGLE+ + GDI
Sbjct: 1   MAQIELRNISKRWGSFVGVDNFDLTIADKEFLVLLGPSGCGKTTTMRMIAGLESASEGDI 60

Query: 61  YIGGDHMNYRVPQNRDIAMVFQDYALYPHMTVRQNIRFGLEEEEGYTSAERDERVVEVAE 120
            + G+ +N   P++RD+AMVFQ YALYP+M V +NIRF L+   G  +   DE+V   + 
Sbjct: 61  LVDGNRVNELEPKDRDVAMVFQSYALYPNMNVYENIRFPLKVR-GVDAKTHDEKVRRASA 119

Query: 121 TLGIADLLDRKPDELSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQNL 180
            + + + L RKP ELSGGQ+QRVAL RAIVR+P VFLMDEPLSNLDAKLR   R +++NL
Sbjct: 120 MVELDEFLHRKPAELSGGQRQRVALARAIVREPNVFLMDEPLSNLDAKLRVSTRAQIKNL 179

Query: 181 QDQLAVTTVYVTHNQTEAMTMADRIAVMDDGELQQVASPFECYHEPNNLFVAEFIGEPMI 240
             +LAVTT+YVTH+Q EAMT+ADR+ VM+ G +QQV SP E Y  P N FVA FIG P +
Sbjct: 180 SHELAVTTIYVTHDQIEAMTLADRVVVMNKGVVQQVGSPTEIYDRPANAFVASFIGSPAM 239

Query: 241 NLVRGTRSESTFVGEHFSYPLDEDVMESVDDRDDFVLGVRPEDIEVADAAPD-DAALDDH 299
           NL+ G  S   F  +H       D+           LG R ED  V D+    +A +   
Sbjct: 240 NLMEGGLSGGRFTAQH------TDIAGLSGQDGPVTLGFRAEDASVVDSGGQINAPIYTM 293

Query: 300 DLQMDVTVVEPHGDQNVLHLSHPDQPSADDALQAVTEGMHLVTRGDRVTVTIPPDKIHLF 359
           +L  D T+V       ++ +       AD   +A  +        D V++ +P D  HLF
Sbjct: 294 ELLGDATMVTVRIGGVLVSV------KADKTFRAEID--------DMVSIHVPTDHCHLF 339

Query: 360 DAETG 364
           D +TG
Sbjct: 340 DTQTG 344


Lambda     K      H
   0.317    0.135    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 366
Number of extensions: 13
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 383
Length of database: 349
Length adjustment: 30
Effective length of query: 353
Effective length of database: 319
Effective search space:   112607
Effective search space used:   112607
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory