Align Arginine decarboxylase proenzyme; ADC; ArgDC; EC 4.1.1.19; Pyruvoyl-dependent arginine decarboxylase (uncharacterized)
to candidate GFF1431 PGA1_c14480 S-adenosylmethionine decarboxylase SpeH
Query= curated2:A2BM05 (142 letters) >FitnessBrowser__Phaeo:GFF1431 Length = 173 Score = 61.6 bits (148), Expect = 6e-15 Identities = 30/76 (39%), Positives = 47/76 (61%), Gaps = 3/76 (3%) Query: 39 EELLKDIVVEAARVANMNLVDIKTWKFTGFHGGVSVIALVLESHISIHTWPDYGYATVDV 98 E +++ + V L+ I T KF+ GVS +A++ ESHIS+HTWP+ GY DV Sbjct: 69 ETRIQNAFRKCVEVCGATLLHIHTHKFSP--QGVSGVAVLAESHISVHTWPEIGYGAFDV 126 Query: 99 YTCGANSDPWKAFNYI 114 + CG +++PWKA + + Sbjct: 127 FMCG-DAEPWKAVDVL 141 Lambda K H 0.318 0.137 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 70 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 142 Length of database: 173 Length adjustment: 17 Effective length of query: 125 Effective length of database: 156 Effective search space: 19500 Effective search space used: 19500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory