Align agmatine deiminase (EC 3.5.3.12) (characterized)
to candidate GFF2608 PGA1_c26490 putative agmatine deiminase
Query= BRENDA::O86509 (339 letters) >FitnessBrowser__Phaeo:GFF2608 Length = 356 Score = 188 bits (477), Expect = 2e-52 Identities = 118/338 (34%), Positives = 171/338 (50%), Gaps = 16/338 (4%) Query: 3 FRMPPEWAPHERTWMAWPGPNATFTDAEELAGARAAWASVARAVRRFEPVTMVHGPGQAA 62 F +PPE APH+R++M WP D A+ + A +A A+ FEPVT++ + Sbjct: 30 FFVPPEEAPHQRSFMQWPVSRKVHPDPVFRDMAQQSIADIANAIAAFEPVTVLAAAADHS 89 Query: 63 TARELLGPDVDLVERELDDAWMRDIGPTFVTDGRGGLAAVDWVFNGWGAQDWARWEHDAE 122 AR L DV+L + +D W RD GP FV DG GG+A FNGWG + + R D++ Sbjct: 90 GARAKLSADVELWDIPTEDLWCRDSGPIFVIDGAGGMAISHIQFNGWGKKQFNR--RDSQ 147 Query: 123 IARHVADLAAAPVLSSPLVNEGGAIHVDGEGTVLLTDTVQLGSGRNPGWSREEVEAEIHA 182 IA VA+ P+L + L E G + DG G ++ ++ + RNPG SR ++E + Sbjct: 148 IAERVAERLGLPLLPTGLHGEAGGVEQDGHGLLMAHESSWVNKNRNPGLSRAQIEQRLLE 207 Query: 183 KLGTTTAIWLPHGLAGDYGRYGTQGHVDIVAAFARPGTVVVHSQRDPRHPDHERSQLYLE 242 G IW G G T H+D +A F PG V+++ P PD ++ Sbjct: 208 AYGADRMIW----AEGVRGEDITDYHIDSLARFTGPGRVLMNL---PDAPD-SADPFHMA 259 Query: 243 IL--RGRTDARGRRLEVVEVPAPTVLKDEEGEWADYSYINHYVCNGGVVLCAFGD-PNDE 299 L R A G +EV +P P + + + ++ SY N+YVCNG V+ FGD DE Sbjct: 260 ALDTHDRLIAAGLGVEV--IPEPHIRRIKSFDFV-ASYANYYVCNGAVIAAEFGDRETDE 316 Query: 300 LAAGIFRRLFPERTVTLVDARTIFAGGGGIHCITQQQP 337 +A R +P R + ++ + GGGIHC TQQ P Sbjct: 317 IARNALARHYPGREIVTLNVDPLGELGGGIHCATQQMP 354 Lambda K H 0.319 0.137 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 403 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 356 Length adjustment: 29 Effective length of query: 310 Effective length of database: 327 Effective search space: 101370 Effective search space used: 101370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory