Align Succinylornithine transaminase; SOAT; Succinylornithine aminotransferase; EC 2.6.1.81 (characterized)
to candidate GFF3179 PGA1_c32300 aminotransferase class-III
Query= SwissProt::Q8ZPV2 (408 letters) >FitnessBrowser__Phaeo:GFF3179 Length = 448 Score = 142 bits (357), Expect = 3e-38 Identities = 120/411 (29%), Positives = 194/411 (47%), Gaps = 42/411 (10%) Query: 22 PFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANR--FWHIGNGYT 79 P I EG + D G ID GG+ LG++ +++A+ Q ++ ++ G + Sbjct: 30 PKIITGAEGVFITDIDGHRVIDGVGGLWNVNLGYSCQPVKDAMAAQLDKLPYYSTFRGTS 89 Query: 80 NEPALRLAKKL---IDATFAERVFFCNSGAEANEAALKLARKYAHDRVGNHKSGIVAFKN 136 N+ A+ L+ +L + R FF + G+++ E AL+LAR+Y R + ++ ++ K Sbjct: 90 NDAAIELSYELSRFFEPDGLSRAFFTSGGSDSVETALRLARQYHKLRGDSGRTKFLSLKK 149 Query: 137 AFHGRTLFTVSAGGQPTYSQDFAPLPPDIRH--AAYNDLNS-------------ASALID 181 +HG + S G + + PL P H A Y N A+AL D Sbjct: 150 GYHGTHIGGASVNGNANFRTAYEPLLPGCFHIPAPYTYRNPFDESDPERLAQLCAAALED 209 Query: 182 D------NT-CAVIVEPVQGEGGVIPATKAFLQGLRELCDRHQALLIFDEVQTGVGRTGE 234 + NT A+I+EP+ G GGVIP +F ++E+C+R+ LLI DEV T GRTG Sbjct: 210 EIAFQGANTIAAMIMEPILGAGGVIPPHPSFAPMVQEICNRNGILLITDEVITAYGRTGA 269 Query: 235 LYAYMHYGVTPDILTTAKALGGG-FPIGAMLTTQDYASVMTPGT-----HGTTYGGNPLA 288 +G+ PD++ TAKA+ G FP GA++ V HG TY G+P+ Sbjct: 270 WSGARLWGIQPDMMCTAKAITNGYFPFGAVMLGARMIEVFEDNPDAKIGHGYTYSGHPVG 329 Query: 289 TAVAGKVLDIINTPEMQNGVRQRHDAFIERLNTLNVRFGMFSEIR-GLGLLLGCVLQTE- 346 A A L + + R E L RF + ++R G GL++ L ++ Sbjct: 330 AAAALTCLAEMQRLNVTATAAARGAQLYEGCLALKERFDVIGDVRGGYGLMIALELVSDR 389 Query: 347 -----FAGKAKLIAQEAA-KAGVMVLIAGGDVVRFAPALNVSDEEIATGLD 391 G+ L QEA +AG ++ ++G +V+ +P L +S+ + LD Sbjct: 390 QTRAPLDGRRALALQEACYEAGALIRVSGPNVI-LSPPLIMSEADTRGLLD 439 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 464 Number of extensions: 32 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 408 Length of database: 448 Length adjustment: 32 Effective length of query: 376 Effective length of database: 416 Effective search space: 156416 Effective search space used: 156416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory