Align 4-aminobutyrate aminotransferase PuuE; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; EC 2.6.1.19 (characterized)
to candidate GFF3422 PGA1_c34750 putative aminotransferase class 3
Query= SwissProt::P50457 (421 letters) >FitnessBrowser__Phaeo:GFF3422 Length = 1009 Score = 144 bits (364), Expect = 9e-39 Identities = 121/399 (30%), Positives = 179/399 (44%), Gaps = 19/399 (4%) Query: 34 LKDVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQFTHTAYQIVPYESYVTLAEKIN 93 L D G Y+D A V + GH HP + A QL++ + P ++ AEKI Sbjct: 615 LFDEWGRPYLD--AYNNVPHVGHAHPRIQAIAADQLKRMNSNTRYLHPAQN--AFAEKI- 669 Query: 94 ALAPVSGQAKTAFFT-TGAEAVENAVKIARAHTGRPGVIAFSGGFHGRTYMTMALTGKVA 152 L+ + + FF +G EA E A+++ARAHTG G++ G+HG T + ++ Sbjct: 670 -LSKMPDHLEVCFFVNSGTEANELALRLARAHTGAKGMVTPDHGYHGNTTGAIDISAYKF 728 Query: 153 PYKIGFGPFPGSVYHVPYPSDLHGISTQDSLDAIER--------LFKSDIEAKQVAAIIF 204 K G GP V V D G +D ++ + K VA I Sbjct: 729 NAKGGVGPSDW-VELVEVADDYRGTYGRDDPQRAQKYADLVDPAIAKLQASGHGVAGFIA 787 Query: 205 EPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEVQSGFARTGKL-FAMDHYADKPDLM 263 E GG + PK + A+ G + IADEVQ+G R G+ F +H PD++ Sbjct: 788 ETFPSVGGQIIPPKGYLPAVYEKIRAAGGICIADEVQTGLGRLGEYYFGFEHQGASPDIV 847 Query: 264 TMAKSLAGGMPLSGVVGNANIMDAPAPGG-LGGTYAGNPLAVAAAHAVLNIIDKESLCER 322 + K + G PL +V I D+ A G T+ G+ L+ VLNI+D+E L E Sbjct: 848 VLGKPIGNGHPLGVLVTTRAIADSFAQGPEFFSTFGGSTLSCRIGTEVLNIVDEEGLQEN 907 Query: 323 ANQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAVEFNDPQTGEPSAAIAQKIQQRALAQG 382 A Q G L N L D + AI VRG+G I VE G ++ I ++ R Sbjct: 908 ARQRGADLLNGLRDLQSRHQAIGDVRGMGLFIGVELIRTD-GSEASEICAYVKNRMRDHR 966 Query: 383 LLLLTCGAYGNVIRFLYPLTIPDAQFDAAMKILQDALSD 421 +L+ + G N+++ PLTI + +K L LS+ Sbjct: 967 ILIGSEGPKDNILKIRPPLTIDAEGIEMILKTLDSILSE 1005 Lambda K H 0.319 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 991 Number of extensions: 49 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 1009 Length adjustment: 38 Effective length of query: 383 Effective length of database: 971 Effective search space: 371893 Effective search space used: 371893 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory