GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gabT in Phaeobacter inhibens BS107

Align Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19) (characterized)
to candidate GFF3179 PGA1_c32300 aminotransferase class-III

Query= reanno::pseudo3_N2E3:AO353_08585
         (454 letters)



>lcl|FitnessBrowser__Phaeo:GFF3179 PGA1_c32300 aminotransferase
           class-III
          Length = 448

 Score =  285 bits (728), Expect = 3e-81
 Identities = 152/414 (36%), Positives = 241/414 (58%), Gaps = 6/414 (1%)

Query: 34  PRIITNAKGVYLWDSEGNKILDGMAGLWCVAIGYGRDELADAASKQMRELPYYNLFFQTA 93
           P+IIT A+GV++ D +G++++DG+ GLW V +GY    + DA + Q+ +LPYY+ F  T+
Sbjct: 30  PKIITGAEGVFITDIDGHRVIDGVGGLWNVNLGYSCQPVKDAMAAQLDKLPYYSTFRGTS 89

Query: 94  HPPVLELAKAISDI-APEGMNHVFFTGSGSEGNDTMLRMVRHYWAIKGQPNKKVIISRIN 152
           +   +EL+  +S    P+G++  FFT  GS+  +T LR+ R Y  ++G   +   +S   
Sbjct: 90  NDAAIELSYELSRFFEPDGLSRAFFTSGGSDSVETALRLARQYHKLRGDSGRTKFLSLKK 149

Query: 153 GYHGSTVAGASLGGMTYMHEQGDLPIPGIVHIPQPYWFGEGGDMT-PEEFGIWAANQLEE 211
           GYHG+ + GAS+ G        +  +PG  HIP PY +    D + PE      A  LE+
Sbjct: 150 GYHGTHIGGASVNGNANFRTAYEPLLPGCFHIPAPYTYRNPFDESDPERLAQLCAAALED 209

Query: 212 KILELGVDTVGAFIAEPIQGAGGVIIPPDSYWPRIKEILAKYDILFVADEVICGFGRTGE 271
           +I   G +T+ A I EPI GAGGVI P  S+ P ++EI  +  IL + DEVI  +GRTG 
Sbjct: 210 EIAFQGANTIAAMIMEPILGAGGVIPPHPSFAPMVQEICNRNGILLITDEVITAYGRTGA 269

Query: 272 WFGSDFYGLKPDMMTIAKGLTSGYIPMGGLIVRDEVVEVLNEGGD--FNHGFTYSGHPVA 329
           W G+  +G++PDMM  AK +T+GY P G +++   ++EV  +  D    HG+TYSGHPV 
Sbjct: 270 WSGARLWGIQPDMMCTAKAITNGYFPFGAVMLGARMIEVFEDNPDAKIGHGYTYSGHPVG 329

Query: 330 AAVALENIRILREEKIIEHVRAETAPYLQKRLRELNDHPLVGEVR-GVGLLGAIELVQDK 388
           AA AL  +  ++   +     A  A   +  L       ++G+VR G GL+ A+ELV D+
Sbjct: 330 AAAALTCLAEMQRLNVTATAAARGAQLYEGCLALKERFDVIGDVRGGYGLMIALELVSDR 389

Query: 389 ATRARYVGKGVGMICRQFCFDNGLIMRAVGDTMIIAPPLVITKAEIDELVTKAR 442
            TRA   G+   +  ++ C++ G ++R  G  +I++PPL++++A+   L+   R
Sbjct: 390 QTRAPLDGRR-ALALQEACYEAGALIRVSGPNVILSPPLIMSEADTRGLLDALR 442


Lambda     K      H
   0.320    0.140    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 554
Number of extensions: 28
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 454
Length of database: 448
Length adjustment: 33
Effective length of query: 421
Effective length of database: 415
Effective search space:   174715
Effective search space used:   174715
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory