GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gabT in Phaeobacter inhibens BS107

Align Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19) (characterized)
to candidate GFF767 PGA1_c07810 aminotransferase class-III

Query= reanno::pseudo3_N2E3:AO353_08585
         (454 letters)



>lcl|FitnessBrowser__Phaeo:GFF767 PGA1_c07810 aminotransferase
           class-III
          Length = 457

 Score =  333 bits (855), Expect = 5e-96
 Identities = 183/456 (40%), Positives = 270/456 (59%), Gaps = 12/456 (2%)

Query: 4   KNPQTREWQTLSSEHHLAPFSDFKQLKEKGPRIITNAKGVYLWDSEGNKILDGMAGLWCV 63
           +N Q  +W   S  H     ++F +      R++T   G ++ D +GN++LD  AGL+CV
Sbjct: 3   RNDQLDQWDRDSFFHPSTHLAEFAR-GNLPQRVVTGGTGCHIEDRDGNRMLDAFAGLYCV 61

Query: 64  AIGYGRDELADAASKQMRELPYYNLFFQTAHPPVLELAKAISDIAPEGMNHVFFTGSGSE 123
            +GYGR E+A+A + Q REL YY+ +        + LAK I D AP+ M+ V+F  SGS+
Sbjct: 62  NVGYGRPEIAEAIADQARELAYYHSYVGHGTEASITLAKMIMDRAPDHMSKVYFGLSGSD 121

Query: 124 GNDTMLRMVRHYWAIKGQPNKKVIISRINGYHGSTVAGASLGGMTYMHEQGDLPIPGIVH 183
            N+T ++++ +Y  I G+P KK IISR  GYHGS +   SL G+   H + DLP+  +VH
Sbjct: 122 ANETNIKLIWYYNNILGRPEKKKIISRWRGYHGSGLMTGSLTGLELFHNKFDLPLAQVVH 181

Query: 184 IPQPYWF-GEGGDMTPEEFGIWAANQLEEKILELGVDTVGAFIAEPIQGAGGVIIPPDSY 242
              PY+F  E    +  +F      +LE  I   G DT+ AFI EP+ G GG++ PP  Y
Sbjct: 182 TESPYYFRREDLSQSEADFVAHCVAELEALIAREGADTIAAFIGEPVLGTGGIVPPPAGY 241

Query: 243 WPRIKEILAKYDILFVADEVICGFGRTGEWFGSDFYGLKPDMMTIAKGLTSGYIPMGGLI 302
           WP I+ +L ++DIL VADEV+ GFGR G  FGSD YG++PD++TIAKGLTS Y P+ G I
Sbjct: 242 WPAIQAVLERHDILLVADEVVTGFGRLGTMFGSDHYGMRPDLITIAKGLTSAYAPLSGSI 301

Query: 303 VRDEVVEVLNEGGDFN----HGFTYSGHPVAAAVALENIRILREEKIIEHVRAETAPYLQ 358
           V D++ +VL  G D N    HG+TYS HP+ AA  + N++++ +  ++E+  A  A YL 
Sbjct: 302 VSDKMWQVLERGTDENGPIGHGWTYSAHPIGAAAGVANLKLIDQLGLVENAGAIGA-YLN 360

Query: 359 KRLRE-LNDHPLVGEVRGVGLLGAIELVQDKATRARY-VGKGVG-MICRQFCFDNGLIMR 415
             +R+ L DHP VG++RG G+L A+E V D+  R  +     +G  I  +    + +I R
Sbjct: 361 DEMRKALGDHPNVGDLRGEGMLCAVEFVADRDDRRFFDASDKIGPQIAAKLLEQDSVIAR 420

Query: 416 AV--GDTMIIAPPLVITKAEIDELVTKARKCLDLTL 449
           A+  GD +  APP  +T+ E D +V    + +   L
Sbjct: 421 AMPQGDILGFAPPFCLTRDEADRVVAATHRAVTAVL 456


Lambda     K      H
   0.320    0.140    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 638
Number of extensions: 38
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 454
Length of database: 457
Length adjustment: 33
Effective length of query: 421
Effective length of database: 424
Effective search space:   178504
Effective search space used:   178504
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory