Align guanidinobutyrase subunit (EC 3.5.3.7) (characterized)
to candidate GFF1959 PGA1_c19920 agmatinase SpeB
Query= metacyc::MONOMER-11557 (320 letters) >FitnessBrowser__Phaeo:GFF1959 Length = 315 Score = 416 bits (1069), Expect = e-121 Identities = 195/311 (62%), Positives = 248/311 (79%) Query: 10 HQPLGGNEMPRFGGIATMLRLPHLQSAKGLDAAFIGVPLDIGTSLRSGTRFGPRQIRAES 69 +QP+ GN++ RF G T +RLP S GLD A +GVP+DIGTS RSGTRFGP+QIRAES Sbjct: 5 NQPISGNDLARFSGPNTFMRLPQATSLDGLDVAILGVPMDIGTSWRSGTRFGPKQIRAES 64 Query: 70 VMIRPYNMATGAAPFDSLSVADIGDVAINTFNLLDAVRIIEEAYDEIVEHNVIPMTLGGD 129 MIRPYNM +GAAPFDSL++ DIGD+AINTF+L D++RII+E+Y I+ +V P+ +GGD Sbjct: 65 AMIRPYNMTSGAAPFDSLNIGDIGDLAINTFSLPDSLRIIQESYSAILASDVTPVAMGGD 124 Query: 130 HTITLPILRALHKKHGKIGLVHIDAHADVNDHMFGEKIAHGTTFRRAVEEGLLDCDRVVQ 189 H+ITLPILRA+ +K+G + LVH+DAHADVND MFGE+ HGT FRRA EEGL+ D+ Q Sbjct: 125 HSITLPILRAVAEKYGPVALVHVDAHADVNDDMFGERETHGTVFRRAYEEGLIVADKTYQ 184 Query: 190 IGLRAQGYTADDFNWSRRQGFRVVQAEECWHKSLEPLMAEVREKVGGGPVYLSFDIDGID 249 IGLR GY ADDF ++R GF+ A E W++SL + AE+R +G PVY+S+DID +D Sbjct: 185 IGLRGTGYGADDFKEAQRWGFQHFPASELWNRSLHGMGAEIRRDIGNRPVYVSYDIDSLD 244 Query: 250 PAWAPGTGTPEIGGLTTIQAMEIIRGCHGLDLIGCDLVEVSPPYDTTGNTSLLGANLLFE 309 PA+APGTGTPEIGGLTT QA+E+IR GL+++GCD+VEVSPPYDT+GNT+L ANLL+E Sbjct: 245 PAYAPGTGTPEIGGLTTPQALELIRALRGLNIVGCDMVEVSPPYDTSGNTALTAANLLYE 304 Query: 310 MLCVLPGVVRR 320 +LCVLPGV + Sbjct: 305 LLCVLPGVTTK 315 Lambda K H 0.322 0.141 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 402 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 315 Length adjustment: 27 Effective length of query: 293 Effective length of database: 288 Effective search space: 84384 Effective search space used: 84384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory