Align putrescine-pyruvate transaminase (EC 2.6.1.113) (characterized)
to candidate GFF919 PGA1_c09350 aminotransferase class-III
Query= BRENDA::Q9I6J2 (456 letters) >FitnessBrowser__Phaeo:GFF919 Length = 450 Score = 321 bits (822), Expect = 3e-92 Identities = 172/419 (41%), Positives = 251/419 (59%), Gaps = 10/419 (2%) Query: 39 ITKAEGVYIWDSEGNKILDAMAGLWCVNVGYGREELVQAATRQMRELPFYNLFFQTAHPP 98 + + EG+Y++DS+G K ++ +AGLWC ++GY E++ A T Q+ +LPF + F H P Sbjct: 19 LERGEGIYVFDSDGRKYIEGLAGLWCTSLGYSNTEVMDAITEQLHKLPFTHTFGGKTHQP 78 Query: 99 VVELAKAIADVAPEGMNHVFFTGSGSEANDTVLRMVRHYWATKGQPQKKVVIGRWNGYHG 158 + +LA +A + P ++FF SGS+ANDT +M+R+Y+ G+P+K+ +I R GYHG Sbjct: 79 IQDLADKLAAMVPVEDAYIFFGNSGSDANDTHYKMLRYYFNAIGKPEKRKIITRERGYHG 138 Query: 159 STVAGVSLGGMKALHEQGDFPIP--GIVHIAQPYWY-GEGGDMSPDEFGVWAAEQLEKKI 215 TVA SL + A D P+ I+ P++Y G+ + +F + LE +I Sbjct: 139 VTVAAGSLTSLPANLAHFDAPLEALSILRADSPHYYTARQGNETEAQFVERILQNLEDQI 198 Query: 216 LEVGEENVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYDILFIADEVICGFGRTGEWF 275 + + +AA I EPI GA GVIVPPD Y+ ++ +L KY IL ADEVICGFGRTG F Sbjct: 199 ISEDPDTIAAMIVEPITGASGVIVPPDGYYEGLQALLRKYGILIWADEVICGFGRTGADF 258 Query: 276 GSQYYGNAPDLMPIAKGLTSGYIPMGGVVV----RDEIVEVLNQGGEFYHGFTYSGHPVA 331 G G PDLM AK L+S Y P+ V+ + +V+ N+ G F HG+TYSGHP A Sbjct: 259 GCTTMGITPDLMTFAKQLSSAYFPISASVIPGWMYEAMVDQTNEVGVFGHGYTYSGHPAA 318 Query: 332 AAVALENIRILREEKIIEKVKAETAPYLQKRWQEL-ADHPLVGEARGVGMVAALELVKNK 390 A AL+ + I + + + AE YLQ + +E+ DHPLVGE RG G++AALELV NK Sbjct: 319 CAAALKTLEIYERDNLFDHA-AEVGSYLQTQLREIFTDHPLVGEVRGKGLIAALELVSNK 377 Query: 391 KTRERFTDKGVGMLCREHCFRNGLIMRAV-GDTMIISPPLVIDPSQIDELITLARKCLD 448 T F G + C NGLI+RAV G+ + + PPL+I ++D+++T + +D Sbjct: 378 TTGASFDKGRAGATAQRLCQDNGLILRAVAGNAVALCPPLIITREEVDDMLTRLKTAID 436 Lambda K H 0.320 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 555 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 456 Length of database: 450 Length adjustment: 33 Effective length of query: 423 Effective length of database: 417 Effective search space: 176391 Effective search space used: 176391 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory