GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rocA in Phaeobacter inhibens BS107

Align L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized)
to candidate GFF2135 PGA1_c21670 betaine aldehyde dehydrogenase BetB

Query= BRENDA::Q72IB9
         (516 letters)



>lcl|FitnessBrowser__Phaeo:GFF2135 PGA1_c21670 betaine aldehyde
           dehydrogenase BetB
          Length = 485

 Score =  235 bits (600), Expect = 2e-66
 Identities = 164/479 (34%), Positives = 236/479 (49%), Gaps = 17/479 (3%)

Query: 41  YIGGEWV-DTKERMVSLNPSAPSEVVGTTAKAGKAEAEAALEAAWKAFKTWKDWPQEDRS 99
           +I GE+V DT    + +  +A  E + T   A  A  E AL  A  A K W      +R 
Sbjct: 12  FINGEYVEDTAGTPIPVIYAATGEQIATVHAATPAIVEQALSTAKAAQKAWARMTGTERG 71

Query: 100 RLLLKAAALMRRRKRELEATLVYEVGKNWVEAS-ADVAEAIDFIEYYARAALRYRYPAVE 158
           R+L +AA +MR R  +L     Y+ GK   E   AD     D +EY+   A        E
Sbjct: 72  RILRRAADIMRERNHDLSVLETYDTGKPLQETLVADATSGADALEYFGGLAASL---TGE 128

Query: 159 VVPYPGEDNESFYVPLGAGVVIAPWNFPVAIFTGMIMGPVAVGNTVIAKPAEDAVVVGAK 218
            +P   +   +    LG  V I  WN+P  I        +A GN+++ KP+E   +   K
Sbjct: 129 HIPLGEDWVYTKREALGLCVGIGAWNYPTQIACWKGAPALACGNSMVFKPSETTPLCALK 188

Query: 219 VFEIFHEAGFPPGVVNFLPGVGEEVGAYLVEHPRTRFINFTGSLEVGLKIYEAAGRLAPG 278
           V EI  EAG P GV N + G+GE VG  LV  PR   ++ TGS+  G K+Y AA      
Sbjct: 189 VAEILIEAGAPAGVFNVVQGMGE-VGGALVTDPRVDKVSLTGSVPTGKKVYAAAAE---- 243

Query: 279 QTWFKRAYVETGGKDAIIVDETADFDLAAEGVVVSAYGFQGQKCSAASRLILTQGAYEPV 338
               K   +E GGK  +I+ + AD D A  G +   +   GQ CS  +R+ + +G  E  
Sbjct: 244 --GMKHVTMELGGKSPLIIFDDADIDNAVGGAINGNFYSSGQVCSNGTRVFVQKGIKEKF 301

Query: 339 LERVLKRAERLSVG-PAEENPDLGPVVSAEQERKVLSYIEIGKNEG-QLVLGGKRLEGEG 396
           L R+ +R     +G P +E    GP+V+  Q   VL YIE GK EG +L+ GG+R + +G
Sbjct: 302 LARLAERTGNAILGDPMDEATSFGPMVTENQMNIVLGYIEKGKEEGARLICGGRRADMDG 361

Query: 397 YFIAPTVFTEVPPKARIAQEEIFGPVLSVIRVKDFAEALEVANDTPYGLTGGVYSRKREH 456
           YFI PTVF +V     IA+EEIFGPV+SV+      E +  ANDT +GL+ GV+++    
Sbjct: 362 YFIEPTVFADVTDDMTIAREEIFGPVMSVLDFDTEEEVVARANDTEFGLSAGVFTKDFTR 421

Query: 457 LEWARREFHVGNLYFNRKITGALVGVQPFGGFKLSGTNAKTGALDYLRLFLEMKAVAER 515
                     G+ + N      +    PFGG K SG   +  + + ++ F ++K+V  R
Sbjct: 422 AHRVIGNLEAGSCFINSYNDAPVEA--PFGGVKASGV-GRENSKEAIKHFSQVKSVYVR 477


Lambda     K      H
   0.319    0.137    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 586
Number of extensions: 39
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 516
Length of database: 485
Length adjustment: 34
Effective length of query: 482
Effective length of database: 451
Effective search space:   217382
Effective search space used:   217382
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory