Align arginase subunit (EC 3.5.3.1) (characterized)
to candidate GFF1615 PGA1_c16370 arginase ArcA
Query= metacyc::MONOMER-11552 (324 letters) >FitnessBrowser__Phaeo:GFF1615 Length = 310 Score = 346 bits (887), Expect = e-100 Identities = 179/307 (58%), Positives = 215/307 (70%), Gaps = 4/307 (1%) Query: 19 KTCQILGAPVQSGASQPGCLMGPDAFRTAGLTQVLTELGWAVTDLGDATP-TVEPELSHP 77 KTC ++GAPV SG + GCLMGPDA+RTAGL + + LG V D G+ P T EP+ + Sbjct: 6 KTCILIGAPVDSGKRRAGCLMGPDAYRTAGLGRAIESLGHKVIDQGNLRPATHEPDTNDG 65 Query: 78 NSAVKNLDALVGWTRSLSQKALEMARSCDLPVFLGGDHSMSAGTVSGVAQRTAELGKEQF 137 +N +GWT L +A E A LP+FLGGDHS+S G+V GVA A+ G+ QF Sbjct: 66 LVFARN--ETIGWTNRLI-RAAEEAMKDGLPIFLGGDHSLSLGSVVGVANHAAKEGRPQF 122 Query: 138 VLWLDAHTDLHTLHTTASGNLHGTPVAYYTGQSGFEGLPPLAAPVNPRNVSMMGIRSVDP 197 VLWLDAHTD HT T+ SGNLHGTPV Y+TG+ F G P +A PV NV M+G+RSVD Sbjct: 123 VLWLDAHTDFHTPATSDSGNLHGTPVGYFTGRPDFAGFPEVANPVPQENVCMIGLRSVDT 182 Query: 198 EERRRVAEIGVQVADMRVLDEQGVVRPLEAFLDRVSKVSGRLHVSLDVDFLDPAIAPAVG 257 ER + + DMR +DE G+ PL AFL RV +G LHVSLDVDFLDP++APAVG Sbjct: 183 PERLALEASDIHRHDMRDIDENGIAGPLSAFLQRVKDANGMLHVSLDVDFLDPSVAPAVG 242 Query: 258 TTVPGGATFREAHLIMEMLHDSGLVTSLDLAELNPFLDERGRTARLITDLASSLFGRRVF 317 TTVPGGAT RE HL+ EMLHDSGL+TSLDL ELNPFLDERGRTA L+ DL +S GRRVF Sbjct: 243 TTVPGGATVREGHLVCEMLHDSGLMTSLDLVELNPFLDERGRTAHLMVDLCASALGRRVF 302 Query: 318 DRVTTAF 324 DR T ++ Sbjct: 303 DRPTRSY 309 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 310 Length adjustment: 27 Effective length of query: 297 Effective length of database: 283 Effective search space: 84051 Effective search space used: 84051 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate GFF1615 PGA1_c16370 (arginase ArcA)
to HMM TIGR01229 (rocF: arginase (EC 3.5.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01229.hmm # target sequence database: /tmp/gapView.11433.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01229 [M=300] Accession: TIGR01229 Description: rocF_arginase: arginase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-90 288.7 0.0 3e-90 288.5 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF1615 PGA1_c16370 arginase ArcA Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF1615 PGA1_c16370 arginase ArcA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 288.5 0.0 3e-90 3e-90 2 298 .. 10 300 .. 9 302 .. 0.96 Alignments for each domain: == domain 1 score: 288.5 bits; conditional E-value: 3e-90 TIGR01229 2 ivglpfseGqgkrGvdkGpkalreaglleklkdlekevedlgqvaaaklekesdreavkaersvlaakeklaekvk 77 ++g+p++ G+ + G+ +Gp+a+r agl +++ l+++v d g+++ a+ e ++++ v a++ ++++l+++++ lcl|FitnessBrowser__Phaeo:GFF1615 10 LIGAPVDSGKRRAGCLMGPDAYRTAGLGRAIESLGHKVIDQGNLRPATHEPDTNDGLVFARNETIGWTNRLIRAAE 85 89***************************************************9999999999************* PP TIGR01229 78 kvveekrfplvLggdHsiaiGtvsgvakkakdk..klgvlwlDAHaDintletstSgnlHGmPlafllgrlkkeve 151 + ++++ +p++LggdHs+ +G+v gva++a+ ++vlwlDAH+D++t+ ts+SgnlHG+P+++++g + ++ lcl|FitnessBrowser__Phaeo:GFF1615 86 EAMKDG-LPIFLGGDHSLSLGSVVGVANHAAKEgrPQFVLWLDAHTDFHTPATSDSGNLHGTPVGYFTG--RPDFA 158 ***999.********************998776669*********************************..78888 PP TIGR01229 152 dleelkllkgkeispkklvyiGlRdvdegErkilkelgikvfsmkeidklGiakvvektleslkaed.pihlSlDv 226 ++e ++ + + +++++iGlR+vd Er +l ++i+ ++m++id++Gia + +l+++k + ++h+SlDv lcl|FitnessBrowser__Phaeo:GFF1615 159 GFPE---VANP-VPQENVCMIGLRSVDTPERLALEASDIHRHDMRDIDENGIAGPLSAFLQRVKDANgMLHVSLDV 230 8999...5554.899*************************************************9999******** PP TIGR01229 227 DglDpklapatGtpvrgGltfrEgklilelllesglltaldlvEvNPtldikeksetikaavelvesllget 298 D+lDp++apa+Gt+v+gG+t rEg+l+ e+l++sgl+t+ldlvE+NP+ld e+++t++ +v+l +s+lg+ lcl|FitnessBrowser__Phaeo:GFF1615 231 DFLDPSVAPAVGTTVPGGATVREGHLVCEMLHDSGLMTSLDLVELNPFLD--ERGRTAHLMVDLCASALGRR 300 **************************************************..******************86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (300 nodes) Target sequences: 1 (310 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.31 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory