Align arginase (EC 3.5.3.1) (characterized)
to candidate GFF1959 PGA1_c19920 agmatinase SpeB
Query= metacyc::MONOMER-14988 (338 letters) >FitnessBrowser__Phaeo:GFF1959 Length = 315 Score = 133 bits (335), Expect = 5e-36 Identities = 95/279 (34%), Positives = 151/279 (54%), Gaps = 18/279 (6%) Query: 62 SLLGIPLGHNSSFLQGPAFAPPLIR-EAIWCGSTNSTTEEGKILDDQRVLTDVGDLPVQE 120 ++LG+P+ +S+ G F P IR E+ N T+ G D + D+GDL + Sbjct: 37 AILGVPMDIGTSWRSGTRFGPKQIRAESAMIRPYNMTS--GAAPFDSLNIGDIGDLAINT 94 Query: 121 LRDTGIDDDRLMSTVSESVKLVMDENPLRPLVLGGDHSISYPVVRAVSEKLGGPVDILHL 180 + D + S S L D + P+ +GGDHSI+ P++RAV+EK G PV ++H+ Sbjct: 95 F---SLPDSLRIIQESYSAILASD---VTPVAMGGDHSITLPILRAVAEKYG-PVALVHV 147 Query: 181 DAHPDIYDAFEGNKYSHASSFARIMEGGY--ARRLLQVGIRSINL--EGREQGKRFGVEQ 236 DAH D+ D G + +H + F R E G A + Q+G+R + ++ +R+G + Sbjct: 148 DAHADVNDDMFGERETHGTVFRRAYEEGLIVADKTYQIGLRGTGYGADDFKEAQRWGFQH 207 Query: 237 YEM-RTFSRDRQFL-ENLKLGEGVKGVYISVDVDCLDPAFAPGVSHFESGGLSFRDVLNI 294 + ++R + ++ G + VY+S D+D LDPA+APG E GGL+ L + Sbjct: 208 FPASELWNRSLHGMGAEIRRDIGNRPVYVSYDIDSLDPAYAPGTGTPEIGGLTTPQALEL 267 Query: 295 LHNLQG-DIVGADVVEYNPQRDTADGMTAMVAAKLVREL 332 + L+G +IVG D+VE +P DT+ G TA+ AA L+ EL Sbjct: 268 IRALRGLNIVGCDMVEVSPPYDTS-GNTALTAANLLYEL 305 Lambda K H 0.317 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 315 Length adjustment: 28 Effective length of query: 310 Effective length of database: 287 Effective search space: 88970 Effective search space used: 88970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory