GapMind for catabolism of small carbon sources

 

Aligments for a candidate for speB in Phaeobacter inhibens BS107

Align agmatinase (EC 3.5.3.11) (characterized)
to candidate GFF31 PGA1_c00310 guanidinobutyrase

Query= BRENDA::W5PHZ9
         (361 letters)



>lcl|FitnessBrowser__Phaeo:GFF31 PGA1_c00310 guanidinobutyrase
          Length = 324

 Score =  268 bits (686), Expect = 1e-76
 Identities = 138/307 (44%), Positives = 196/307 (63%), Gaps = 6/307 (1%)

Query: 53  PPSSEFVARSVGICSMMRLPMQATPEGL----DAALVGVPLDIGTSNRPGARFGPRRIRE 108
           P S   + R  G+ + MRLP     + +       LVGVP D GT+NRPG R GPR++R+
Sbjct: 11  PVSGMEMPRFAGLPTFMRLPHVTVSDPIIDQVQLGLVGVPWDAGTTNRPGPRHGPRQLRD 70

Query: 109 ESVMLRTANPSTGAVPFQFLKVADLGDVNVNLYNLQDSCRLIRADYQKIVAAGCVPLTLG 168
            S M+R  NP TG  PF  +  ADLGDV  N  ++ D    I A Y  + +     LT+G
Sbjct: 71  LSTMIRAGNPVTGINPFSMINCADLGDVAPNPVDIIDCMERISAFYADLKSRDIFALTVG 130

Query: 169 GDHTITYPILQAIAEKHGPVGLVHVDAHMDTADKALGEKLY-HGTPFRRCVDEGLLDCKR 227
           GDH ++ P+L+ +A    PVGL+  D+H D  D   G   Y HGTPFRR ++EGL+D KR
Sbjct: 131 GDHLVSLPVLRGLASG-APVGLIQFDSHTDLFDSYFGGNKYTHGTPFRRAIEEGLVDPKR 189

Query: 228 VVQIGIRGSSTTLDTYRYSRSQGFRVVLAEDCWLKSLVPLMGEVRQQMGGRPIYISFDID 287
           +VQIGIRG++   +   + ++QG R++  E+ + + +  +M EVR+ +G +P Y ++DID
Sbjct: 190 MVQIGIRGTAYNTEDVEWGQAQGVRIIRIEEFFDRGVSDVMREVREIVGDQPTYCTYDID 249

Query: 288 GLDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVVGCDLVEVSPPYDPSGNTALVAANL 347
            +DPA+APGTGTPE+ G    QAL+++R   G+ +VG DLVEVSPP+D +GNTA + A++
Sbjct: 250 FVDPAFAPGTGTPEVGGPNSFQALQVVRELAGVQLVGADLVEVSPPFDTNGNTAWLGASI 309

Query: 348 LFEMLCV 354
           LFEMLCV
Sbjct: 310 LFEMLCV 316


Lambda     K      H
   0.321    0.139    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 391
Number of extensions: 21
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 361
Length of database: 324
Length adjustment: 29
Effective length of query: 332
Effective length of database: 295
Effective search space:    97940
Effective search space used:    97940
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate GFF31 PGA1_c00310 (guanidinobutyrase)
to HMM TIGR01230 (speB: agmatinase (EC 3.5.3.11))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01230.hmm
# target sequence database:        /tmp/gapView.9617.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01230  [M=275]
Accession:   TIGR01230
Description: agmatinase: agmatinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                        Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                        -----------
    1.6e-57  181.2   0.0    1.9e-57  180.9   0.0    1.0  1  lcl|FitnessBrowser__Phaeo:GFF31  PGA1_c00310 guanidinobutyrase


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Phaeo:GFF31  PGA1_c00310 guanidinobutyrase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  180.9   0.0   1.9e-57   1.9e-57       6     274 ..      35     315 ..      31     316 .. 0.90

  Alignments for each domain:
  == domain 1  score: 180.9 bits;  conditional E-value: 1.9e-57
                        TIGR01230   6 seaeyeeAevvivgiPydattsyrpGsrhgpeaireastnLeayseeld.rdlallkvvDagdlplaaGdaremveki 82 
                                      s+++ ++ +  +vg+P+da t  rpG rhgp ++r+ st + a ++  +   +++++ +D+gd+     d  + +e+i
  lcl|FitnessBrowser__Phaeo:GFF31  35 SDPIIDQVQLGLVGVPWDAGTTNRPGPRHGPRQLRDLSTMIRAGNPVTGiNPFSMINCADLGDVAPNPVDIIDCMERI 112
                                      5666677777799************************************5559***********999999999***** PP

                        TIGR01230  83 eevveelleegkfvvaiGGeHsitlpvirAvkkkfeklavvqfDAHtDlrde.fegeklshacvmrrvlelg....ln 155
                                       +  ++l     f +++GG+H+++lpv+r  ++   ++ ++qfD HtDl d  f g+k++h ++ rr++e g    ++
  lcl|FitnessBrowser__Phaeo:GFF31 113 SAFYADLKSRDIFALTVGGDHLVSLPVLRGLASG-APVGLIQFDSHTDLFDSyFGGNKYTHGTPFRRAIEEGlvdpKR 189
                                      ******999999******************9986.689************87257899************9988889* PP

                        TIGR01230 156 vlqigiRsg..ikeeadlarennikvlk.relede.....iaevlakvldkpvyvtiDiDvlDPafaPGvgtpepgGl 225
                                      ++qigiR      e+ ++ + +++++++  e+ d+     + ev  +v d+p y t DiD +DPafaPG+gtpe+gG 
  lcl|FitnessBrowser__Phaeo:GFF31 190 MVQIGIRGTayNTEDVEWGQAQGVRIIRiEEFFDRgvsdvMREVREIVGDQPTYCTYDIDFVDPAFAPGTGTPEVGGP 267
                                      *******65225899********99876444444443333999999******************************** PP

                        TIGR01230 226 tskellklfvlaekekkvvGlDvvEvaPvydssevtaltaaklalelll 274
                                      +s ++l+  v++   +++vG+D+vEv+P +d++  ta + a +  e+l 
  lcl|FitnessBrowser__Phaeo:GFF31 268 NSFQALQ-VVRELAGVQLVGADLVEVSPPFDTNGNTAWLGASILFEMLC 315
                                      *******.8999***********************************96 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (275 nodes)
Target sequences:                          1  (324 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 9.56
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory