Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate GFF3831 PGA1_262p02350 histidine transport ATP-binding protein HisP
Query= TCDB::Q52666 (263 letters) >FitnessBrowser__Phaeo:GFF3831 Length = 281 Score = 234 bits (597), Expect = 1e-66 Identities = 120/246 (48%), Positives = 168/246 (68%), Gaps = 7/246 (2%) Query: 22 AIQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGKIIV 81 AI++ ++K +G VL+ ++LT +G+ + I G SGSGKSTM+RCIN LE SG+I++ Sbjct: 35 AIRVCDLHKSFGSLEVLKGVSLTAKQGDVVAIIGGSGSGKSTMLRCINFLETPNSGEIVI 94 Query: 82 DGIELT-------SDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVPKREA 134 G + +D + I+++R+ + MVFQ FNL+ H T+LEN+ P+ V KVP+ EA Sbjct: 95 AGETVAMRQDGSPADRRQIERIRTRLAMVFQQFNLWTHRTLLENVIEVPVHVLKVPRSEA 154 Query: 135 EETAMYYLEKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMIK 194 A L +V + ++A +P LSGGQQQR AIAR+L + P +MLFDEPTSALDPE++ Sbjct: 155 IHRAHELLARVGLGDKADAFPAFLSGGQQQRAAIARALAVDPNVMLFDEPTSALDPELVG 214 Query: 195 EVLDTMIQLAEEGMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFHNPQSERTK 254 EVL + LA EG TML VTHEM FA+ VAN V+++ +G+I EQ P + F NP+SER K Sbjct: 215 EVLTVIRDLAAEGRTMLLVTHEMKFAREVANHVVYLFEGRIEEQGPPSEVFGNPKSERLK 274 Query: 255 QFLSQI 260 QFLS + Sbjct: 275 QFLSSV 280 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 281 Length adjustment: 25 Effective length of query: 238 Effective length of database: 256 Effective search space: 60928 Effective search space used: 60928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory