Align AapJ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)
to candidate GFF194 PGA1_c01980 glutamate/glutamine/aspartate/asparagine-binding protein BztA
Query= TCDB::Q52812 (341 letters) >FitnessBrowser__Phaeo:GFF194 Length = 338 Score = 400 bits (1029), Expect = e-116 Identities = 199/342 (58%), Positives = 244/342 (71%), Gaps = 5/342 (1%) Query: 1 MKNKLLSAAIGAAVLAVGASAASATTLSDVKAKGFVQCGVNTGLTGFAAPDASGNWAGFD 60 MKNK++ A+ A LA GA+AA TL DVKA+G + CGV TGL GFAAP+A+G W GFD Sbjct: 1 MKNKVILGALTIAGLAAGAAAAG--TLDDVKARGKLNCGVTTGLVGFAAPNANGEWEGFD 58 Query: 61 VDFCKAVASAVFGDPTKVKYTPTNAKERFTALQSGEIDVLSRNTTWTINRDTALGFNFRP 120 V C+AVA+AV GD T V++ PT K RFTAL SGEID+L+RNTTWT +RD L F F Sbjct: 59 VAVCRAVAAAVLGDSTAVEFVPTTGKTRFTALASGEIDMLARNTTWTFSRDVDLKFEFVG 118 Query: 121 VTYYDGQGFMVRKGLNVKSALELSGAAICVQSGTTTELNLADYFKTNNLQYNPVVFENLP 180 V YYDGQGFMV K L V SA EL GA +C+Q+GTTTELNLAD+F++NN+ Y PV E Sbjct: 119 VNYYDGQGFMVPKELGVSSAKELDGATVCIQTGTTTELNLADFFRSNNISYEPVPIETNA 178 Query: 181 EVNAAYDAGRCDVYTTDQSGLYSLRLTLKNPDEHIILPEIISKEPLGPAVRQGDDQWFDI 240 E Y AG CDVYTTD SGL + R T +P H++LPEIISKEPLGP VR GD +W D+ Sbjct: 179 EAQQQYLAGACDVYTTDASGLAATRATFDDPSAHVLLPEIISKEPLGPLVRHGDHEWGDV 238 Query: 241 VSWTAYALINAEEFGITQANVDEM-KNSPNPDIKRFLGSETDTKIGTDLGLTNDWAANVI 299 V W+ AL+ AEE G+T AN+ EM + NP+I R LG T+ +G LGL+ DWA N I Sbjct: 239 VRWSLNALVAAEELGVTSANIGEMAAGTENPEINRLLG--TEGTLGEMLGLSADWAKNAI 296 Query: 300 KGVGNYGEIFERNIGQGSPLKIARGLNALWNKGGIQYAPPVR 341 GNYGE+F +NIG+ +P+ +ARGLNA W +GG+ YAPP R Sbjct: 297 GAGGNYGEVFAKNIGEDTPIGLARGLNAQWTEGGLLYAPPFR 338 Lambda K H 0.316 0.134 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 338 Length adjustment: 28 Effective length of query: 313 Effective length of database: 310 Effective search space: 97030 Effective search space used: 97030 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory