Align ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 1 (characterized)
to candidate GFF2619 PGA1_c26600 amino acid ABC transporter, permease protein
Query= reanno::pseudo3_N2E3:AO353_16280 (223 letters) >FitnessBrowser__Phaeo:GFF2619 Length = 273 Score = 87.8 bits (216), Expect = 2e-22 Identities = 62/216 (28%), Positives = 109/216 (50%), Gaps = 11/216 (5%) Query: 15 MWNGMVMTLQLTVLGVVGGIILGTLLALMRLSHSKLLSNIAGAYVNYFRSIPLLLVITW- 73 + G+ +T+ +T++ +LG LAL S ++ A Y+ R IP+++++ + Sbjct: 49 LMRGVQLTIFVTLISFFLASLLGLGLALAAGSRWLVIRQGARFYIEVVRGIPIIVLLLYV 108 Query: 74 -FYLAVPFV-LRWITGEDTPIGAFTS--------CIVAFMMFEAAYFCEIVRAGVQSIPK 123 F LA V LR G+ + + I+A M+ +A+ E+ RAG+QS+ + Sbjct: 109 AFVLAPALVELRNWLGDHIGLDPIRTRNFPLLWRAIIALMIAYSAFISEVFRAGLQSVDE 168 Query: 124 GQMGAAKALGMGYGQMMRLIILPQAFRKMTPLLLQQSIILFQDTSLVYTVGLVDFLNATR 183 GQ+ AAK+LG+ R I+ PQA R + P L + L +D+SLV +G+ D + Sbjct: 169 GQIEAAKSLGLSRWHRFRFIVFPQAIRTILPPLGNDFVALVKDSSLVSVLGVADVTQLGK 228 Query: 184 ASGDIIGRANEFLIIAGLVYFTISFAASRLVKRLQK 219 + R E + L+Y T++ S L++R +K Sbjct: 229 LTAVGNFRYFETYNVVALIYLTLTIGLSLLLRRFEK 264 Lambda K H 0.331 0.143 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 124 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 223 Length of database: 273 Length adjustment: 24 Effective length of query: 199 Effective length of database: 249 Effective search space: 49551 Effective search space used: 49551 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory