Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate GFF3910 PGA1_65p00130 putative amino-acid ABC transporter, ATP-binding protein
Query= TCDB::Q52666 (263 letters) >FitnessBrowser__Phaeo:GFF3910 Length = 251 Score = 205 bits (521), Expect = 9e-58 Identities = 111/242 (45%), Positives = 155/242 (64%), Gaps = 3/242 (1%) Query: 22 AIQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGKIIV 81 AI I+ + K +G VL I+LT+ GERIVI GPSG+GKST++RC+N L+ +G + + Sbjct: 9 AISITGLRKTFGDSVVLDGIDLTIQPGERIVIIGPSGTGKSTLLRCLNFLDAPDAGLVRI 68 Query: 82 DGIELTS---DLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVPKREAEETA 138 +++ + I +R VFQ++ LF + T EN+ A I V+K P+ EAE A Sbjct: 69 GDLDVDAARASKAEILALRRRTAFVFQNYALFANKTAAENIMEALITVQKQPRAEAEARA 128 Query: 139 MYYLEKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMIKEVLD 198 L + + ++A YP LSGGQQQRV I R++ + ++MLFDEPTSALDPE + EVL Sbjct: 129 REILAETGLADKADAYPASLSGGQQQRVGIGRAMALGAELMLFDEPTSALDPEWVGEVLA 188 Query: 199 TMIQLAEEGMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFHNPQSERTKQFLS 258 M ++AEE TML VTHEM FA+ +A+RV+FM G+IVEQ P F PQ RT+ FL Sbjct: 189 LMHKVAEERQTMLIVTHEMQFAREIADRVVFMEGGRIVEQGPPTQIFDAPQDPRTRAFLR 248 Query: 259 QI 260 ++ Sbjct: 249 RV 250 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 251 Length adjustment: 24 Effective length of query: 239 Effective length of database: 227 Effective search space: 54253 Effective search space used: 54253 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory