Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate GFF3910 PGA1_65p00130 putative amino-acid ABC transporter, ATP-binding protein
Query= TCDB::A3ZI83 (242 letters) >FitnessBrowser__Phaeo:GFF3910 Length = 251 Score = 202 bits (515), Expect = 4e-57 Identities = 107/242 (44%), Positives = 161/242 (66%), Gaps = 5/242 (2%) Query: 2 IELKNVNKYYGTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVVVN 61 I + + K +G VL I+L+++ GE++VIIGPSG+GKST +RC+N L+ +G V + Sbjct: 10 ISITGLRKTFGDSVVLDGIDLTIQPGERIVIIGPSGTGKSTLLRCLNFLDAPDAGLVRIG 69 Query: 62 NLVLN----HKNKIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEETAF 117 +L ++ K +I R+ A VFQ++ L+ + T +N+ A + +QK+ + EAE A Sbjct: 70 DLDVDAARASKAEILALRRRTAFVFQNYALFANKTAAENIMEALITVQKQPRAEAEARAR 129 Query: 118 KYLKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLDV 177 + L GL DKA+ YPA+LSGGQQQRV I R++ +LFDEPTSALDPE + EVL + Sbjct: 130 EILAETGLADKADAYPASLSGGQQQRVGIGRAMALGAELMLFDEPTSALDPEWVGEVLAL 189 Query: 178 MKEISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFSNPKTERARLFLG 237 M +++ + TM++VTHEM FA+E+ADR++FME G IVE+ P++ F P+ R R FL Sbjct: 190 MHKVA-EERQTMLIVTHEMQFAREIADRVVFMEGGRIVEQGPPTQIFDAPQDPRTRAFLR 248 Query: 238 KI 239 ++ Sbjct: 249 RV 250 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 126 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 251 Length adjustment: 24 Effective length of query: 218 Effective length of database: 227 Effective search space: 49486 Effective search space used: 49486 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory