Align ABC transporter for D-Cellobiose and D-Salicin, permease component 1 (characterized)
to candidate GFF3854 PGA1_78p00180 putative sn-glycerol-3-phosphate transport system permease protein UgpE
Query= reanno::Smeli:SMc04257 (305 letters) >FitnessBrowser__Phaeo:GFF3854 Length = 309 Score = 503 bits (1296), Expect = e-147 Identities = 236/303 (77%), Positives = 279/303 (92%), Gaps = 3/303 (0%) Query: 6 ETAPGGPMA---GPRGRKPRRTLSRRNIIVYGTLIVVALYYLLPLYVMIVTSLKGMPEIR 62 +T G P+ GPRG KP+ +SRRN+++YGTL+++ALYYLLPLYVM+VTSLKGMPEIR Sbjct: 7 QTPKGSPVRILDGPRGAKPKTRVSRRNVMLYGTLLLIALYYLLPLYVMVVTSLKGMPEIR 66 Query: 63 VGNIFAPPLEITFEPWVKAWAEACTGLNCDGLSRGFWNSVRITVPSVIISIAIASVNGYA 122 +GNIF+PP+EITF+PW+KAW+EACTG+NCDGLSRGF NS++I VPSV +SIAIASVNGYA Sbjct: 67 LGNIFSPPVEITFQPWIKAWSEACTGINCDGLSRGFGNSIKILVPSVALSIAIASVNGYA 126 Query: 123 LANWRFKGADLFFTILIVGAFIPYQVMIYPIVIVLREMGVYGTLTGLIIVHTIFGMPILT 182 LANWRFKG++ FFTILI+GAFIPYQ M+YPIVI+LRE+ + G+L GL++VH+IFGMPILT Sbjct: 127 LANWRFKGSETFFTILIIGAFIPYQTMLYPIVIILRELKLMGSLWGLVLVHSIFGMPILT 186 Query: 183 LLFRNYFAGLPEELFKAARVDGAGFWTIYFKIMLPMSLPIFVVAMILQVTGIWNDFLFGV 242 LLFRNYF+ LPEELFKAARVDGAGFW IY ++M+PMS+PIFVVAMILQVTGIWNDFLFGV Sbjct: 187 LLFRNYFSSLPEELFKAARVDGAGFWGIYLRVMVPMSIPIFVVAMILQVTGIWNDFLFGV 246 Query: 243 VFTRPEYYPMTVQLNNIVNSVQGVKEYNVNMAATILTGLVPLTVYFVSGRLFVRGIAAGA 302 ++T+PE YPMTVQLNNIVNSVQGVKEYNVNMAAT+LTGLVPL +Y VSG+LFVRGIAAGA Sbjct: 247 IYTKPETYPMTVQLNNIVNSVQGVKEYNVNMAATLLTGLVPLVIYLVSGKLFVRGIAAGA 306 Query: 303 VKG 305 VKG Sbjct: 307 VKG 309 Lambda K H 0.329 0.145 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 411 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 309 Length adjustment: 27 Effective length of query: 278 Effective length of database: 282 Effective search space: 78396 Effective search space used: 78396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory