Align ABC transporter for D-Cellobiose and D-Salicin, permease component 1 (characterized)
to candidate GFF774 PGA1_c07880 alpha-glucoside transport system permease protein AglG
Query= reanno::Smeli:SMc04257 (305 letters) >FitnessBrowser__Phaeo:GFF774 Length = 382 Score = 130 bits (328), Expect = 4e-35 Identities = 74/220 (33%), Positives = 119/220 (54%), Gaps = 3/220 (1%) Query: 87 TGLNCDGLSRGFWNSVRITVPSVIISIAIASVNGYALANWRFKGADLFFTILIVGAFIPY 146 +G + D +++ F+N++ +T+P+ II I +A+ YALA F G L ++ +P Sbjct: 164 SGNSTDNMAKAFFNTLTVTIPATIIPILVAAFAAYALAWMEFPGRALLVAAIVGLLVVPL 223 Query: 147 QVMIYPIVIVLREMGVYGTLTGLIIVHTIFGMPILTLLFRNYFAGLPEELFKAARVDGAG 206 Q+ + P++ E+G+ G+ + HT FG+P+ L RNY G+P ++ + ARVDGA Sbjct: 224 QLALIPLLKFHNEIGIGKGYIGVWMAHTGFGLPLAIYLLRNYMVGIPRDIIENARVDGAT 283 Query: 207 FWTIYFKIMLPMSLPIFVVAMILQVTGIWNDFLFGVVFTRPEYYPMTVQLNNIVNSVQGV 266 + I+ +I+LP+S P I Q WND L +VF TV IV + G Sbjct: 284 DFLIFVRIILPLSFPALASFAIFQFLWTWNDLLVAMVFLIDATGETTVMTKQIV-ELLGT 342 Query: 267 KEYNVNMAAT--ILTGLVPLTVYFVSGRLFVRGIAAGAVK 304 + N + AT ++ VPL V+F + VRG+ AG+VK Sbjct: 343 RGGNWEILATSAFVSIAVPLAVFFAMQKYLVRGLLAGSVK 382 Lambda K H 0.329 0.145 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 382 Length adjustment: 29 Effective length of query: 276 Effective length of database: 353 Effective search space: 97428 Effective search space used: 97428 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory