Align CBP protein aka CebG, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized)
to candidate GFF3033 PGA1_c30820 putative ABC transporter permease protein
Query= TCDB::Q9X9R5 (276 letters) >FitnessBrowser__Phaeo:GFF3033 Length = 320 Score = 122 bits (305), Expect = 1e-32 Identities = 73/223 (32%), Positives = 115/223 (51%), Gaps = 8/223 (3%) Query: 58 NLEAAWEQAGLGTAMLNSVIVAGTITVSTVLFSTLAGFAFAKLRFRFSGLLLLLTIGTMM 117 N A+ +A L +LN +IV G+I + V+ + A +A AKL+F + L + ++ Sbjct: 101 NYSKAFTEAPLLRYLLNGIIVTGSIFLIQVVVALPAAYALAKLKFWGREAVFGLVLFCLL 160 Query: 118 IPPQLAVVPLYLWMSDLGWSNQLHTVILPSLVTAFGTFFMRQYLVQALPTELIEAARVDG 177 IP +PLY+ ++ LG +N +++P ++ FG F MRQ+ + +P +LI+AAR+DG Sbjct: 161 IPVHAIALPLYIMLAKLGLTNTYAALVVPWTISVFGIFLMRQFFM-TVPDDLIDAARMDG 219 Query: 178 ASSLRIVWHVVFPAARPAMAVLGLLTFVFAWNDFLWPIIALNQQNPTVQVGPELARHRVL 237 IVW V+ P A PA+ + + V WND+ WP I + P L Sbjct: 220 MGEFSIVWRVMLPTAIPALLAFAIFSIVAHWNDYFWPRIVVTGNRDLFT--PPLGLREFK 277 Query: 238 PDQ-----AVIMAGALLGTLPLLVAFLLFGKQIVGGIMQGAIK 275 D +MA A + PL+VAFLL K+ + GI +K Sbjct: 278 GDGDGSYFGPMMATATVIVTPLIVAFLLAQKRFIEGITLSGMK 320 Lambda K H 0.327 0.140 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 320 Length adjustment: 26 Effective length of query: 250 Effective length of database: 294 Effective search space: 73500 Effective search space used: 73500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory