Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate GFF1647 PGA1_c16700 binding protein-dependent transport system, inner membrane component
Query= uniprot:A3DE72 (327 letters) >FitnessBrowser__Phaeo:GFF1647 Length = 316 Score = 151 bits (381), Expect = 2e-41 Identities = 97/289 (33%), Positives = 146/289 (50%), Gaps = 18/289 (6%) Query: 32 YAMLIPTFVCMMCIHFIPMLQGIYLSLLDLNQLTMTKFLNAPFIGLKNYYEILFDEKSLI 91 + L P + + + IP++ GI S + L ++G +NY ++ D K Sbjct: 34 FLYLSPMILLIGSVMLIPLIVGISYSFQSIELLNP---FATGWVGFENYEKLWSDRK--- 87 Query: 92 RRGFWFALRNTAIYTVVVTFATFALGIILAMLVNREFKGRGIVRTALLMPWVVPSYVVGM 151 FW AL NT +T F F LG+ LAML+N +F G+ + + + +PW VP+++ + Sbjct: 88 ---FWIALENTFFWTFWSIFFQFFLGLGLAMLLNTQFFGKKLFQALVFLPWAVPTFLSAL 144 Query: 152 TWGFLWRQDSGLINIILCDILHILPEKPYWLVGSNQ--IWAIIIPTIWRGLPLSMILMLA 209 TW +L+ G I L L +L E PY ++G IW I IW G+P I +LA Sbjct: 145 TWAWLFNPVIGPIPHWLA-ALGVLSE-PYNILGDPDLAIWGPITANIWFGVPFFAITLLA 202 Query: 210 GLQSISPDYYEAADIDGANGWQKFWHITLPLLKPILAINVMFSLISNIYSFNIVSMMFGN 269 LQSI + YEAA+IDGA WQ F ITLP L P++AI VM + I+ N ++F Sbjct: 203 ALQSIPGELYEAAEIDGATPWQSFTKITLPFLAPMIAITVM---LRTIWIANFADLIFVM 259 Query: 270 GAGIPGEWGDLLMTYIQRNTFQMWRFGPGA--AALMIVMFFVLGIVALW 316 G P +L TYI F+ FG + A ++++ ++ LW Sbjct: 260 TGGGPANSTQILSTYIFTTAFRKLDFGYASTIAVALLIILLAYAVILLW 308 Lambda K H 0.330 0.145 0.468 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 385 Number of extensions: 25 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 316 Length adjustment: 28 Effective length of query: 299 Effective length of database: 288 Effective search space: 86112 Effective search space used: 86112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory