Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate GFF260 PGA1_c02720 sn-glycerol-3-phosphate transport system permease protein UgpA
Query= uniprot:A3DHA3 (284 letters) >FitnessBrowser__Phaeo:GFF260 Length = 293 Score = 105 bits (263), Expect = 9e-28 Identities = 86/278 (30%), Positives = 134/278 (48%), Gaps = 12/278 (4%) Query: 11 LFSSPYLAGFLIFFAIPSAMSVYYCFTR----GVGSFEFAGLDNFKSVIASNSYRLAVKN 66 L P L IFF P+ ++ F G GS F GLDN+ ++ ++ YR Sbjct: 14 LLLMPQLVIIAIFFYWPAWHAIQSSFYLQDPFGFGS-TFVGLDNYTDLLGNSEYRRVAIF 72 Query: 67 TLIFNSVSVPVIMIVSLLLAMLLNKALRGARYFR--MFFVLPLVIPVASIILVWQITFNE 124 TL+F + + ++LLLA+ + LRGAR +R + +V + PVA I + I F++ Sbjct: 73 TLVFTVLVTFFSLAIALLLAVKADNVLRGARTYRTLLMWVYAVAPPVAGFIGL--IMFDQ 130 Query: 125 -FGVLNNLLNHFGIAGVEWLNSKWSIAVLVLLYVWKNCGYNIILFTAGLNSIPKDYYDAA 183 +G L L FG V +N + A +VL+ VWK N I F +GL SIP+ +AA Sbjct: 131 SWGPLTRLAGFFGWDFVLGVNFNDTAAAMVLVSVWKQIPVNFIFFLSGLQSIPRSVREAA 190 Query: 184 SIDGAGGFKCFTSITLPLLVPTIFFVFIISIINS-FKVFREAYLLCGNYPPLN-MYMLQH 241 ID F +T PLL PT FF+ II+I + F F L P N M ++ Sbjct: 191 LIDNRSATGRFWDVTFPLLAPTGFFLLIINITYALFDTFGIVDTLVKGEPGNNPMTLVYK 250 Query: 242 FMNNNFNNLNYQRLSTASLLMELFIVAIVFLMYKIEGR 279 + F + S S+++ + ++A+ +++ R Sbjct: 251 VYVDGFRGNDLGGSSAQSVILMVLVLALTIFQFRLIDR 288 Lambda K H 0.331 0.144 0.444 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 284 Length of database: 293 Length adjustment: 26 Effective length of query: 258 Effective length of database: 267 Effective search space: 68886 Effective search space used: 68886 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory