Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate GFF774 PGA1_c07880 alpha-glucoside transport system permease protein AglG
Query= uniprot:A3DHA2 (303 letters) >FitnessBrowser__Phaeo:GFF774 Length = 382 Score = 95.1 bits (235), Expect = 2e-24 Identities = 68/234 (29%), Positives = 110/234 (47%), Gaps = 10/234 (4%) Query: 80 IPDMVSMKQYYTVLFR---KPTFLLMFLNSAIMTIPIVIIQVIVGVFAAYAFAKLRFPLR 136 +P +++ Y TVL F N+ +TIP II ++V FAAYA A + FP R Sbjct: 149 VPPEFTLENYETVLISGNSTDNMAKAFFNTLTVTIPATIIPILVAAFAAYALAWMEFPGR 208 Query: 137 DKLFFVFIVVMLMPLQVTLVPNYILLRKLDMIGSFLSVILPG-GFSA-FGVVLLRQYMRG 194 L + ++++PLQ+ L+P ++ + ++ V + GF + LLR YM G Sbjct: 209 ALLVAAIVGLLVVPLQLALIPLLKFHNEIGIGKGYIGVWMAHTGFGLPLAIYLLRNYMVG 268 Query: 195 IPDECCEAAMIDGAGYLKTFTKIILPQCKSIIASLAILAFIDNWNMVEQPLIFLSD---- 250 IP + E A +DGA F +IILP +AS AI F+ WN + ++FL D Sbjct: 269 IPRDIIENARVDGATDFLIFVRIILPLSFPALASFAIFQFLWTWNDLLVAMVFLIDATGE 328 Query: 251 -SAKYPLSVYLAYINEGDLGLAFASGVLYMIPTVLIYLYGEKYFVEGIQLTGIK 303 + V L G+ + S + + + ++ +KY V G+ +K Sbjct: 329 TTVMTKQIVELLGTRGGNWEILATSAFVSIAVPLAVFFAMQKYLVRGLLAGSVK 382 Lambda K H 0.331 0.147 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 382 Length adjustment: 28 Effective length of query: 275 Effective length of database: 354 Effective search space: 97350 Effective search space used: 97350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory