Align MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized)
to candidate GFF729 PGA1_c07440 ABC transporter, ATP binding protein
Query= TCDB::P96483 (377 letters) >FitnessBrowser__Phaeo:GFF729 Length = 353 Score = 328 bits (841), Expect = 1e-94 Identities = 188/379 (49%), Positives = 245/379 (64%), Gaps = 31/379 (8%) Query: 1 MATVTFDKATRIYPGSDKPAVDQLDIAIEDGEFLVLVGPSGCGKSTSLRMLAGLEDVNGG 60 M VT KA + Y D + +D++I+DGEF V VGPSGCGKST LRM+AGLE+ + G Sbjct: 1 MTGVTLAKAVKKY--GDVQVIHDVDLSIDDGEFCVFVGPSGCGKSTLLRMIAGLEETSSG 58 Query: 61 AIRIGDRDVTHLPPKDRDIAMVFQNYALYPHMTVADNMGFALKIAGVPKAEIRQKVEEAA 120 I IGDRDVT L DR +AMVFQ+YALYPHMTV DNMGF LK+ G PK +IR+KV EA+ Sbjct: 59 NIHIGDRDVTRLDAADRGVAMVFQSYALYPHMTVEDNMGFGLKMNGHPKEKIREKVAEAS 118 Query: 121 KILDLTQYLDRKPKALSGGQRQRVAMGRAIVREPQVFLMDEPLSNLDAKLRVSTRTQIAS 180 +IL L YL RKPKALSGGQRQRVA+GRAIVR P+VFL DEPLSNLDA+LRV R +IA Sbjct: 119 RILKLDDYLKRKPKALSGGQRQRVAIGRAIVRGPEVFLFDEPLSNLDAELRVDMRVEIAR 178 Query: 181 LQRRLGITTVYVTHDQVEAMTMGDRVAVLKDGLLQQVDSPRNMYDKPANLFVAGFIGSPA 240 L + +G T +YVTHDQVEAMT+ D++ VL+ G ++QV SP +Y P N FVAGFIGSP+ Sbjct: 179 LHKEIGATMIYVTHDQVEAMTLADKIVVLRAGRVEQVGSPMELYANPDNRFVAGFIGSPS 238 Query: 241 MNLVEVPITDGGVKFGNSVVPV---NREALSAADKGDRT-VTVGVRPEHFDVVELGGAVA 296 MN +E + GV VVP R A S A D + V +G+RP+H Sbjct: 239 MNFLEGTVQGDGV-----VVPALENRRVATSVALPADGSKVLLGLRPQH----------- 282 Query: 297 ASLSKDSADAPAGLAVSVNVVEELGADGYVYGTAEVGGEVKDLVVRVNGRQVPEKGSTLH 356 LS +AD+ ++ +++ E LG Y Y + G + L+V G + +G+ + Sbjct: 283 --LSVTAADS----SLVLDLRERLGGVSYDYLSTPTG---EKLIVETRGDEALPEGTAVA 333 Query: 357 VVPRPGETHVFSTSTGERL 375 + + ++F +T +RL Sbjct: 334 LGFDDADAYIFDGATEQRL 352 Lambda K H 0.317 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 353 Length adjustment: 30 Effective length of query: 347 Effective length of database: 323 Effective search space: 112081 Effective search space used: 112081 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory