Align iron(III) dicitrate transport system permease protein FecD (characterized)
to candidate GFF2549 PGA1_c25900 putative iron ABC transport system, permease protein
Query= CharProtDB::CH_004160 (318 letters) >FitnessBrowser__Phaeo:GFF2549 Length = 343 Score = 164 bits (414), Expect = 4e-45 Identities = 114/313 (36%), Positives = 164/313 (52%), Gaps = 7/313 (2%) Query: 9 ITLALAGCALLSLHMGVIPVPWRAL---LTDWQAGHEHYYVLMEYRLPRLLLALFVGAAL 65 +TL L A LSL G W + LT + + + V+ RLPRL+ A GAAL Sbjct: 27 LTLCLLSAAALSL--GARATSWAEIWGGLTAYDPNNADHIVVRNMRLPRLIGAGLAGAAL 84 Query: 66 AVAGVLIQGIVRNPLASPDILGVNHAASLASVGALLLMPSLPVMVLPLLAFAGGMAGLIL 125 ++G LIQ + RNPLA P +LG+N A+L V +L++ +A GG+A +L Sbjct: 85 GMSGALIQAMTRNPLADPGLLGINGGAALGVVLCILVLGVTDPAEFIWVALGGGLAASVL 144 Query: 126 LKMLAKTHQ--PMKLALTGVALSACWASLTDYLMLSRPQDVNNALLWLTGSLWGRDWSFV 183 + +L Q P++L L G A+SA + +LT L+L Q ++ W+ G G + + Sbjct: 145 VFLLGGGSQANPLRLILAGAAVSALFLALTRALLLVSRQTLDVYRFWVLGGFDGILPATL 204 Query: 184 KIAIPLMILFLPLSLSFCRDLDLLALGDARATTLGVSVPHTRFWALLLAVAMTSTGVAAC 243 + +P +IL L++ L+ L LG+ A LGV TR A V + VA Sbjct: 205 QSLLPFLILGALLAIIAGFGLNALMLGEDTAKGLGVRTGLTRLTAGAAIVLLCGATVAMA 264 Query: 244 GPISFIGLVVPHMMRSITGGRHRRLLPVSALTGALLLVVADLLARIIHPPLELPVGVLTA 303 GPI+F GL+VPHM R G L SA+ GALLL+ ADLL R+ + GV+TA Sbjct: 265 GPIAFAGLIVPHMARWAAGPAIGWSLAFSAVFGALLLIAADLLGRLALFGGNMQAGVMTA 324 Query: 304 IIGAPWFVWLLVR 316 +IG P +WL+ R Sbjct: 325 LIGGPVLIWLVRR 337 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 343 Length adjustment: 28 Effective length of query: 290 Effective length of database: 315 Effective search space: 91350 Effective search space used: 91350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory