Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate GFF2646 PGA1_c26860 putative iron transport system, ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >FitnessBrowser__Phaeo:GFF2646 Length = 261 Score = 155 bits (393), Expect = 6e-43 Identities = 89/244 (36%), Positives = 143/244 (58%), Gaps = 7/244 (2%) Query: 10 VSYGTDK----VLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLGDNP 65 VS+G + +L+ +S L G++ ++GPNG GKS+LL R P+SG V +GD+ Sbjct: 11 VSWGPGRAAPLILHPISFHLDAGRVLGVVGPNGAGKSSLLRVIYRFNQPRSGKVEVGDSD 70 Query: 66 INMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVAMNQ 125 I L + A+R++ + Q T +TV E+V+ GR P+ S + A D A + +++ Sbjct: 71 IWALPPKAAAQRVAAVLQEQPTDFALTVAEIVALGRAPYRSGFATPGARDAAIIEGMLDR 130 Query: 126 TRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRLMGELR 185 + +A R LSGG+RQR +A LAQ +++LDEPT +LDI HQ+D++ L+ +L Sbjct: 131 LDLYSMADRAFGTLSGGERQRVMVARALAQEPSLLVLDEPTNHLDIRHQLDVLDLIRDLD 190 Query: 186 TQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSVEAEIHPEP 245 T+V LHDLN A+ CD++++M+ G +A GTP +V++ + VF+V A Sbjct: 191 V---TIVTSLHDLNIAAGACDEILLMSEGRQLAFGTPHDVLSEDTVSRVFNVAARRETLT 247 Query: 246 VSGR 249 SG+ Sbjct: 248 PSGQ 251 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 261 Length adjustment: 24 Effective length of query: 231 Effective length of database: 237 Effective search space: 54747 Effective search space used: 54747 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory