Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate GFF3872 PGA1_78p00360 putative ferrichrome transport ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >FitnessBrowser__Phaeo:GFF3872 Length = 252 Score = 165 bits (417), Expect = 1e-45 Identities = 101/245 (41%), Positives = 140/245 (57%), Gaps = 5/245 (2%) Query: 8 LTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLGDNPIN 67 L+ + G +L+ V LP G+ITALIGPNG GKSTLL ++ L G + L + Sbjct: 7 LSFTLGDKPILDTVDACLPAGQITALIGPNGAGKSTLLKLIAQQLTASWGRICLSGCDLR 66 Query: 68 MLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVAMNQTR 127 ++ QLARR++++ Q + V++LV +GR W GRL AED A + A+ Sbjct: 67 SITPEQLARRMAVVGQQLDVASRVRVRDLVGFGR--WPHSRGRLRAEDQAAIADALALFE 124 Query: 128 INHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRLMGELR-T 186 ++ L R L ELSGGQRQRAF+AM AQ+T +LLDEP LD+NH +LM + L T Sbjct: 125 LDDLRDRFLDELSGGQRQRAFIAMAYAQDTDWLLLDEPLNNLDLNHARNLMAQLRHLADT 184 Query: 187 QGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSVEAEIHPEPV 246 +GK++V VLHDLN A + D +V +A G V G EV T L ++ + V Sbjct: 185 RGKSIVIVLHDLNYAISWADHVVALAAGRVAFAGPVAEVATSESLSALYQTPVAL--REV 242 Query: 247 SGRPM 251 GRP+ Sbjct: 243 EGRPI 247 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 252 Length adjustment: 24 Effective length of query: 231 Effective length of database: 228 Effective search space: 52668 Effective search space used: 52668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory