Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; PCA reductase; EC 1.5.1.2 (characterized)
to candidate GFF2438 PGA1_c24700 pyrroline-5-carboxylate reductase ProC
Query= SwissProt::P22008 (273 letters) >FitnessBrowser__Phaeo:GFF2438 Length = 275 Score = 181 bits (458), Expect = 2e-50 Identities = 111/267 (41%), Positives = 153/267 (57%), Gaps = 6/267 (2%) Query: 5 RIAFIGAGNMAASLIGGLRAQGVPAAQIRASDPGAEQRAKIAGEFAIDVVESNAEAVADA 64 RIA +G G M ++++ G +GV + DP + G + + EA ADA Sbjct: 10 RIALLGCGKMGSAMLAGWLDRGVSPEAVWVIDPNPSDWLRQTG---VHINAPLPEAGADA 66 Query: 65 D-VVVLSVKPQAMKAVCQALAPALKPEQLIVSIAAGIPCASLEAWLGQPRPVVRCMPNTP 123 +V+++VKPQ M L E L +S+AAG A+ E+ LG P+VR MPNTP Sbjct: 67 PGIVLIAVKPQMMGEALPQLQQLGNGETLFISVAAGTSIATYESLLGAETPIVRAMPNTP 126 Query: 124 ALLRQGASGLYANAQVSAAQCEQAGQLLSAVGIALWLDDEAQIDAVTAVSGSGPAYFFLL 183 A + +G + + NA SA +A LL A+G + L EAQ+DAVT VSGSGPAY F L Sbjct: 127 AAVGRGITAIIGNASASADDVIRADALLKAIGQTVRLQSEAQMDAVTGVSGSGPAYVFHL 186 Query: 184 MQAMTDAGEKLGLSRETASRLTLQTALGAAQMALSSEVEPAELRRRVTSPNGTTEAAIKS 243 ++ + AGE GL E A +L T GA +A ++E PAELR VTSPNGTT+AA++ Sbjct: 187 IETLAAAGEAEGLPAELAMQLAKATVAGAGALAEAAEETPAELRVNVTSPNGTTQAALEV 246 Query: 244 F--QANGFEALVEQALNAASQRSAELA 268 + NGF L+ +A+ AAS RS EL+ Sbjct: 247 LMDEDNGFPPLLRRAVAAASNRSKELS 273 Lambda K H 0.315 0.127 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 275 Length adjustment: 25 Effective length of query: 248 Effective length of database: 250 Effective search space: 62000 Effective search space used: 62000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
Align candidate GFF2438 PGA1_c24700 (pyrroline-5-carboxylate reductase ProC)
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00112.hmm # target sequence database: /tmp/gapView.18237.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00112 [M=263] Accession: TIGR00112 Description: proC: pyrroline-5-carboxylate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-78 250.4 3.0 1.3e-78 250.2 3.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF2438 PGA1_c24700 pyrroline-5-carboxyl Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF2438 PGA1_c24700 pyrroline-5-carboxylate reductase ProC # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 250.2 3.0 1.3e-78 1.3e-78 1 263 [] 11 272 .. 11 272 .. 0.93 Alignments for each domain: == domain 1 score: 250.2 bits; conditional E-value: 1.3e-78 TIGR00112 1 iaiiGaGnmgeallsgllkkgakakkeilvierseeklaalakelgvevtsdaeeavkea.dvvllavKPqdleev 75 ia++G+G+mg+a+l+g+l +g++ ++ ++vi+++++ + ++gv+ +++ ea ++a +vl+avKPq++ e+ lcl|FitnessBrowser__Phaeo:GFF2438 11 IALLGCGKMGSAMLAGWLDRGVS-PEAVWVIDPNPSD---WLRQTGVHINAPLPEAGADApGIVLIAVKPQMMGEA 82 799****************9887.9*******88654...45566777777776666555279999********** PP TIGR00112 76 laelkseektkeklliSilAGvtiekleqlleaekrvvRvmPNtaakvgagvtaiaassevseeqkelveellkav 151 l +l++ + e+l+iS++AG++i+++e+ll+ae+++vR+mPNt+a+vg+g+tai+ ++ +s+++ ++++llka+ lcl|FitnessBrowser__Phaeo:GFF2438 83 LPQLQQ-LGNGETLFISVAAGTSIATYESLLGAETPIVRAMPNTPAAVGRGITAIIGNASASADDVIRADALLKAI 157 *****9.66699**************************************************************** PP TIGR00112 152 Gkvveve.eklldavtalsGSgPAfvflliealadagvklGLpreeakelaaqtlkGaaklleesgehpalLkdkV 226 G++v+++ e+++davt++sGSgPA+vf+lie la+ag ++GLp+e+a++la++t++Ga++l e +e+pa+L+ +V lcl|FitnessBrowser__Phaeo:GFF2438 158 GQTVRLQsEAQMDAVTGVSGSGPAYVFHLIETLAAAGEAEGLPAELAMQLAKATVAGAGALAEAAEETPAELRVNV 233 **************************************************************************** PP TIGR00112 227 tsPgGtTiaglavL..eekgvrsavieaveaavkrseeL 263 tsP+GtT+a+l+vL e++g+ + +av aa++rs+eL lcl|FitnessBrowser__Phaeo:GFF2438 234 TSPNGTTQAALEVLmdEDNGFPPLLRRAVAAASNRSKEL 272 **************444567*****************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (275 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 8.78 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory