Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate GFF197 PGA1_c02010 glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD
Query= uniprot:A0A1N7U8S3 (276 letters) >FitnessBrowser__Phaeo:GFF197 Length = 263 Score = 225 bits (574), Expect = 7e-64 Identities = 121/256 (47%), Positives = 169/256 (66%), Gaps = 12/256 (4%) Query: 21 VTAAIKLQVEGIHKRYGEHEVLKGVSLNARQGDVISLIGASGSGKSTMLRCINFLEQPDA 80 V+ + +++ ++K YG VL+ ++L QG+ I + G SGSGKST++RC+N LE+ Sbjct: 17 VSDEVAIEINNMNKWYGSFHVLRDINLTVNQGERIVIAGPSGSGKSTLIRCLNALEEHQQ 76 Query: 81 GVITLDGISIEMRQGRAGTRAPHQDQLQNLRTRLAMVFQHFNLWSHMTVLENITMAPRRV 140 G I +DG + + + +R+ + MVFQHFNL+ H+T+LEN T+AP V Sbjct: 77 GNIMVDGTEL----------SNDLKNIDKIRSEVGMVFQHFNLFPHLTILENCTLAPIWV 126 Query: 141 LDVSAAEAEKRARMYLDKVGLPSRVADQYPAFLSGGQQQRVAIARALAMEPEIILFDEPT 200 EAE+RA +L+KV +P + A +YP LSGGQQQRVAIAR+L M P I+LFDEPT Sbjct: 127 RKTPKKEAEERAMHFLEKVKIPDQ-AHKYPGMLSGGQQQRVAIARSLCMMPRIMLFDEPT 185 Query: 201 SALDPELVGEVLKVIQTLAEEGRTMLMVTHEMGFARQVSSQVLFLHQGR-VEEHGDARIL 259 SALDPE++ EVL + LAEEG TML VTHEMGFARQV+++V+F+ G+ VE++ Sbjct: 186 SALDPEMIKEVLDTMIELAEEGMTMLCVTHEMGFARQVANRVIFMDAGQIVEQNEPEEFF 245 Query: 260 DQPNSERLQQFLSNRL 275 + P SER + FLS L Sbjct: 246 NNPQSERTKLFLSQIL 261 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 263 Length adjustment: 25 Effective length of query: 251 Effective length of database: 238 Effective search space: 59738 Effective search space used: 59738 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory