Align 5-aminovalerate transaminase (EC 2.6.1.48) (characterized)
to candidate GFF2829 PGA1_c28750 aminotransferase class-III
Query= BRENDA::Q9I6M4 (426 letters) >FitnessBrowser__Phaeo:GFF2829 Length = 440 Score = 183 bits (464), Expect = 1e-50 Identities = 134/373 (35%), Positives = 184/373 (49%), Gaps = 26/373 (6%) Query: 38 DVEGREYIDFAGGIAVLNTGHLHPKVIAAVQEQLGKLSHTCFQVLAYEPYIELAEEIAKR 97 D G+ Y+D +GG AV GH +VIAAVQEQ+GKL+ L EP LA+ + + Sbjct: 26 DANGKRYLDGSGGAAVSCLGHSDAEVIAAVQEQVGKLAFAHTGFLTSEPAEALADLLISQ 85 Query: 98 VPGDFPKKTLLVTSGSEAVENAVKIAR------AATGRAGVIAFTGAYHGRTMMTLGLTG 151 PGD + V+ GSEA E A+K+AR T R VIA +YHG T+ L G Sbjct: 86 APGDL-HRVYFVSGGSEATEAAIKLARQYHLERGDTTRRHVIARRQSYHGNTLGALAAGG 144 Query: 152 KVVPYSAGMGLMPGGIFRALAPC-ELHGVSEDDSIASIERIFKNDAQ-------PQDIAA 203 L+ +APC E + +S + N+ + P+ + A Sbjct: 145 NAWRRQQFAPLLID--ISHIAPCYEYVDRGDGESRYDYGQRVANELEAEILRLGPETVMA 202 Query: 204 IIIEPVQGE-GGFYVNSKSFMQRLRALCDQHGILLIADEVQTGAGRTGTFFATEQLGIVP 262 + EPV G G + + +R+R +CDQ+G+LLI DEV G GRTG FA E G+ P Sbjct: 203 FMAEPVVGATSGAVPAVEGYFKRIREICDQYGVLLILDEVMCGMGRTGHLFACEADGVAP 262 Query: 263 DLTTFAKSVGGGF-PISGVAGKAEIMDAIAPGG----LGGTYAGSPIACAAALAVLKVFE 317 D+ AK +G G+ PI + +I DAI G G TY G P+A AA LAV++ Sbjct: 263 DILCIAKGLGAGYQPIGAMLCSRQIYDAIEGGSGFFQHGHTYIGHPVATAAGLAVVRALL 322 Query: 318 EEKLLERSQAVGERLKAGLREIQAKHKVIGDVRGLGSMVAIELF---EGGDTHKPAAELV 374 + L++RS +GE L A L +H +GD+RG G IEL E P + Sbjct: 323 DRGLVQRSAEMGETLHAALVARFGQHPHVGDLRGRGLFRGIELVADRESKTPFDPGLGIA 382 Query: 375 SKIVVRAREKGLI 387 K+ A E GLI Sbjct: 383 GKLKKAAFEAGLI 395 Lambda K H 0.319 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 513 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 440 Length adjustment: 32 Effective length of query: 394 Effective length of database: 408 Effective search space: 160752 Effective search space used: 160752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory