Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate GFF1117 PGA1_c11320 3-hydroxyacyl-CoA dehydrogenase type-2
Query= BRENDA::Q99714 (261 letters) >FitnessBrowser__Phaeo:GFF1117 Length = 251 Score = 267 bits (683), Expect = 1e-76 Identities = 143/248 (57%), Positives = 177/248 (71%), Gaps = 4/248 (1%) Query: 13 AVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQ 72 AVITGGASGLG ATA GA LLD G A A ++G + FA DVTSE+ V Sbjct: 8 AVITGGASGLGEATARHFAANGAQVTLLDRDAERGAAVAAEIGGH--FAQTDVTSEESVA 65 Query: 73 TALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLV 132 A+ALA K G+++ VNCAGIA+ KT + H L+ +QR +D+NL+GTFNV RL Sbjct: 66 AAMALASEKMGKINACVNCAGIALGIKTVG--RDGAHPLDAYQRTIDINLVGTFNVARLA 123 Query: 133 AGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIR 192 A E+ + + + G RGVIINTAS+AAF+GQ GQAAY+ASKGG+VGM LP+ARDLA G+R Sbjct: 124 AVEIAKCDAAEDGGRGVIINTASIAAFDGQKGQAAYAASKGGVVGMCLPMARDLASSGVR 183 Query: 193 VMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIR 252 VMTIAPG+F TP+L LPE+V LA+ VP P+RLGDPAEY L I+E +LNGEVIR Sbjct: 184 VMTIAPGIFMTPMLAGLPEEVQQQLAADVPNPARLGDPAEYGRLAGFIVEMGYLNGEVIR 243 Query: 253 LDGAIRMQ 260 LDGA+RM+ Sbjct: 244 LDGALRMR 251 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 251 Length adjustment: 24 Effective length of query: 237 Effective length of database: 227 Effective search space: 53799 Effective search space used: 53799 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory