Align proline racemase (EC 5.1.1.4) (characterized)
to candidate GFF500 PGA1_c05120 4-hydroxyproline epimerase
Query= BRENDA::B8LFE4 (345 letters) >FitnessBrowser__Phaeo:GFF500 Length = 314 Score = 156 bits (394), Expect = 8e-43 Identities = 115/339 (33%), Positives = 169/339 (49%), Gaps = 33/339 (9%) Query: 7 MTCIDMHTAGEPARIVTSGFPNIPGASLVEKRDHLQRHMDHIRRRVMLEPRGHDNMFGAF 66 M ID HT GEP R++ SG P++ SL ++ L R V+ EPRGHD M GA Sbjct: 1 MRVIDSHTGGEPTRLILSGGPDLGDGSLTDRAHRLFRDHRDFCSAVLSEPRGHDAMVGAL 60 Query: 67 LFYPLTDGADFSVIFMDAGGYLNMCGHNSIAIATAAVEMGMVHPTPDASQMPLVLDTPAG 126 L P A +VI+ + G L MCGH +I A + +G + D + ++TP G Sbjct: 61 LVPPTDPIAAAAVIYFNPIGPLGMCGHATIGAAASLHHLGRL----DLGRHH--IETPVG 114 Query: 127 RVLTDVHLEWNKGVCEVHHVAVKNVPSFLYMQDIVVELPHPYGKVTVDISFGGSFFALID 186 V VHL+ + AV+NV S Y + VE+P G+++ DI++GG++F L Sbjct: 115 TV--GVHLQ------TANRAAVENVESDRYRAGVAVEVP-GQGRISGDIAWGGNWFFLTS 165 Query: 187 AAQLQLTVDKGHLSTLQHVGGLLRDTL-NRNVSVQHPQLPHINRIDCVEIYDPPTNPAAS 245 LT+ H+ L LR L + ++ + + ID +E PP Sbjct: 166 DVPAPLTL--AHVDRLTTSAVALRQALAEQGITGRDGAM-----IDHIEFVGPPLTSIGH 218 Query: 246 CKNVVIFGNSQVDRSPCGTGTCAKMALLYAKGKLKVGDTFVHESISGTLF--HGKLLNQV 303 +N V+ + DRSPCGTG+ AK+A L A G L G T++ ES+ + + H + Sbjct: 219 ARNFVLCPGTAYDRSPCGTGSAAKLACLAADGDLAPGVTWIQESVISSTYALHYR----- 273 Query: 304 SMPGVKYPAVISEISGSAYITGFNTLLFAPRDPFRDGFT 342 PG VI+ I+G+A++TG L F P DP+R G T Sbjct: 274 --PG-PTGGVIATITGTAFVTGDTVLNFDPADPYRAGIT 309 Lambda K H 0.323 0.139 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 12 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 314 Length adjustment: 28 Effective length of query: 317 Effective length of database: 286 Effective search space: 90662 Effective search space used: 90662 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory