Align Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94) (characterized)
to candidate GFF976 PGA1_c09920 putative gamma-glutamyl-gamma-aminobutyrate hydrolase
Query= reanno::pseudo3_N2E3:AO353_29305 (253 letters) >FitnessBrowser__Phaeo:GFF976 Length = 259 Score = 175 bits (444), Expect = 7e-49 Identities = 99/231 (42%), Positives = 127/231 (54%), Gaps = 4/231 (1%) Query: 19 HPYHVSGDKYLRAVSVAALGLPVVIPSLGELTEIDELLAHLDGLLLTGSPSNVEPFHYQG 78 +P H G AV+ A +P++IPS ++ELL DG LLTG NV P Y Sbjct: 19 YPAHAGGTMNSEAVAEVAGCMPLLIPSDPRFLSVEELLESFDGFLLTGGRPNVHPNEYGE 78 Query: 79 PASAPGTDHDPARDSTTLPLLRAAIAAGVPVLGICRGFQEMNVAFGGSLHQKVHELPGML 138 + D ARD+ LPL+RA + G P LGICRGFQE+NVA GG+L+ ++ +LPG + Sbjct: 79 AETDAHGAFDRARDAIALPLVRACVERGQPFLGICRGFQEVNVAMGGTLYPEIRDLPGRM 138 Query: 139 DHREADHPDLAVQYAPAHAVSVQPGGVFQALELPPVFQVNSIHSQGIDRLAPGLRA--EA 196 +HR L ++A H V + GGVF L NS+H QGI APG R + Sbjct: 139 NHRMPPDGTLEEKFAMRHIVELTEGGVFHRLFGAAEVMTNSLHGQGIK--APGSRIVIDG 196 Query: 197 IAPDGLIEAISVEHSKAFALGVQWHPEWQVLANPPYLSIFQAFGDACRQRA 247 APDG EAI V+ + F L VQWHPEW +P +F AFGDA R A Sbjct: 197 TAPDGTPEAIYVKDAPGFTLAVQWHPEWDAANDPVSRPLFTAFGDAVRDWA 247 Lambda K H 0.320 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 245 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 253 Length of database: 259 Length adjustment: 24 Effective length of query: 229 Effective length of database: 235 Effective search space: 53815 Effective search space used: 53815 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory