Align propionate kinase (EC 2.7.2.15) (characterized)
to candidate GFF2838 PGA1_c28840 acetate kinase AckA
Query= BRENDA::O06961 (402 letters) >FitnessBrowser__Phaeo:GFF2838 Length = 386 Score = 242 bits (617), Expect = 2e-68 Identities = 155/384 (40%), Positives = 218/384 (56%), Gaps = 14/384 (3%) Query: 7 VLVINCGSSSIKFSVLDVATCDVLMAGIADGMNTENAFLSINGDKPINLAHSNYEDALKA 66 +L++N GSSSIKF++ D + +AG+A+G+ T + L I D + + +AL A Sbjct: 9 ILILNAGSSSIKFAIFDT-DLNQRLAGLAEGIGTPQSRLRI-ADTSRDSQLPTHAEALAA 66 Query: 67 IAFELEKRDLTDS-VALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSG 125 I L L + +A +GHR+ HGG T+ V IT EI I +PLAPLHN +L+ Sbjct: 67 ILAALPDHGLDPTQLAAVGHRVVHGGRKLTKPVRITPEIRAEIADCTPLAPLHNPHSLAA 126 Query: 126 IDAARHLFPAVRQVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRR 185 ID P + Q A FDTSFH T A Y +P + G+RRYGFHG S+ + RR Sbjct: 127 IDTMATTAPDLPQFASFDTSFHATNPEVATRYAIP-RVEETKGIRRYGFHGLSYASLVRR 185 Query: 186 AYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAM 245 E+ S L+ HLGNGAS+CA+RNGQSV T+MG +PL+GL MGTRSG +D A+ Sbjct: 186 LPEISGA-ALPSRLLAFHLGNGASLCAIRNGQSVATTMGYSPLDGLTMGTRSGGIDANAV 244 Query: 246 AWIAKETGQTLSDLERVVNKESGLLGISGLSSDLRVLEKAWHEGHERARLAIKTFVHRIA 305 + ++ G L + ++N ESGLLG+SG SD+R L + + AI+ F + Sbjct: 245 LRLVEDNG--LDRTKAILNNESGLLGLSGGKSDMRNL---MLDPSADSAFAIEHFCYWSL 299 Query: 306 RHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQPNSHGERII 365 RH A++ LD I FTGGIGEN+V +R ++ L +G +DV+ N S + Sbjct: 300 RHAGSLIAAMEGLDAIAFTGGIGENAVGVRARILRGLEWIGARMDVDANHARKSR----L 355 Query: 366 SANPSQVICAVIPTNEEKMIALDA 389 A S+V V+ EE+ IA+DA Sbjct: 356 HAGSSKVAIWVVEAEEERQIAMDA 379 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 380 Number of extensions: 25 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 386 Length adjustment: 31 Effective length of query: 371 Effective length of database: 355 Effective search space: 131705 Effective search space used: 131705 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate GFF2838 PGA1_c28840 (acetate kinase AckA)
to HMM TIGR00016 (ackA: acetate kinase (EC 2.7.2.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00016.hmm # target sequence database: /tmp/gapView.26754.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00016 [M=405] Accession: TIGR00016 Description: ackA: acetate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-107 344.9 0.0 3.2e-107 344.7 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF2838 PGA1_c28840 acetate kinase AckA Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF2838 PGA1_c28840 acetate kinase AckA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 344.7 0.0 3.2e-107 3.2e-107 4 403 .. 7 382 .. 4 384 .. 0.92 Alignments for each domain: == domain 1 score: 344.7 bits; conditional E-value: 3.2e-107 TIGR00016 4 kkilvlnaGssslkfalldaensekvllsglverikleeariktvedgekkeeeklaiedheeavkkllntlkkdk 79 il+lnaGsss+kfa++d+ ++ l gl+e i +++r+ + + + + + h+ea++++l +l d+ lcl|FitnessBrowser__Phaeo:GFF2838 7 DNILILNAGSSSIKFAIFDTDL-NQR-LAGLAEGIGTPQSRLRIADT-----SRDSQLPTHAEALAAILAALP-DH 74 679****************994.565.69***********7664333.....35678899*************.67 PP TIGR00016 80 kilkelseialiGHRvvhGgekftesvivtdevlkkikdiselAPlHnpaelegieavlklkvllkaknvavFDta 155 + + ++a++GHRvvhGg k+t+ v +t e+ ++i+d ++lAPlHnp l +i+++ ++ ++ ++ a FDt+ lcl|FitnessBrowser__Phaeo:GFF2838 75 GL--DPTQLAAVGHRVVHGGRKLTKPVRITPEIRAEIADCTPLAPLHNPHSLAAIDTMA--TTAPDLPQFASFDTS 146 65..5679*************************************************99..899999********* PP TIGR00016 156 fHqtipeeaylYalPyslykelgvRrYGfHGtshkyvtqraakllnkplddlnlivcHlGnGasvsavknGksidt 231 fH t pe a Ya+P ++++ +g+RrYGfHG+s+ + +r+ ++ + + ++l+ HlGnGas++a++nG+s+ t lcl|FitnessBrowser__Phaeo:GFF2838 147 FHATNPEVATRYAIP-RVEETKGIRRYGFHGLSYASLVRRLPEISGA-ALPSRLLAFHLGNGASLCAIRNGQSVAT 220 ***************.8999************************998.56889*********************** PP TIGR00016 232 smGltPLeGlvmGtRsGdiDpaiisylaetlglsldeieetlnkksGllgisglssDlRdildkkeegneeaklAl 307 +mG PL+Gl mGtRsG iD ++ l e +g ld + +ln +sGllg+sg sD+R+++ ++ +++ A+ lcl|FitnessBrowser__Phaeo:GFF2838 221 TMGYSPLDGLTMGTRSGGIDANAVLRLVEDNG--LDRTKAILNNESGLLGLSGGKSDMRNLMLDP---SADSAFAI 291 *********************99998888766..678899*********************9999...45789*** PP TIGR00016 308 kvyvhRiakyigkyiaslegelDaivFtgGiGenaaevrelvleklevlGlkldlelnnaarsgkesvisteeskv 383 + +++ ++ g+ ia++eg lDai FtgGiGena+ vr+++l++le +G ++d + n+ ++s + skv lcl|FitnessBrowser__Phaeo:GFF2838 292 EHFCYWSLRHAGSLIAAMEG-LDAIAFTGGIGENAVGVRARILRGLEWIGARMDVDANH----ARKSRLHAGSSKV 362 ******************99.************************************99....4555667789*** PP TIGR00016 384 kvlviptneelviaeDalrl 403 + v++ +ee ia Da l lcl|FitnessBrowser__Phaeo:GFF2838 363 AIWVVEAEEERQIAMDAQTL 382 ****************9877 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (405 nodes) Target sequences: 1 (386 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.08 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory