Align Phosphopentomutase (EC 5.4.2.7) (characterized)
to candidate GFF1180 PGA1_c11950 phosphopentomutase DeoB
Query= reanno::Dino:3607415 (399 letters) >FitnessBrowser__Phaeo:GFF1180 Length = 406 Score = 517 bits (1331), Expect = e-151 Identities = 262/404 (64%), Positives = 302/404 (74%), Gaps = 6/404 (1%) Query: 1 MTRAFLIVMDSVGCGGAPDAA-----DFGDEGANTLAHIAQACAAGRADAGRSGPLRMPV 55 M RAFL+VMDSVG GGAPDA D D GANTLAHIAQACAAG+A+ GRSGPL +P Sbjct: 1 MPRAFLVVMDSVGIGGAPDAGAYFNGDLPDLGANTLAHIAQACAAGQAEEGRSGPLHLPN 60 Query: 56 LDGLGLGAAIRLASGAETPGLA-ATPTGLWGAATEVSRGKDTPTGHWELAGVPVPWEWTT 114 LD LGLGAA+ L S P L A TG WGAA E+SRGKDTP+GHWELAG+PVPW+W Sbjct: 61 LDQLGLGAAVALVSAVPCPDLGGAGVTGRWGAAREISRGKDTPSGHWELAGLPVPWDWCY 120 Query: 115 FPDTDPAFPPDLLAEMARAAGTEGTLCNTHASGTEVIERFGAEHLRTGWPICYTSVDSVL 174 FPD PAFP L+A + AAGTE L N HASGT +I GA H+++G PICYTS DSV Sbjct: 121 FPDQTPAFPDHLVAHVCAAAGTEAILGNCHASGTAIIAEHGAAHMQSGLPICYTSADSVF 180 Query: 175 QIAAHEEAFGLDRLLDVCETLAPRLHAMKVGRVIARPFLGSEATGFARTQNRRDFAIAPP 234 QIAAHEE FGL+RLL +CE +AP LH MKVGRVIARPF+G+ TGF RT NRRD+AI PP Sbjct: 181 QIAAHEETFGLNRLLALCEAVAPYLHQMKVGRVIARPFIGTPQTGFQRTTNRRDYAIMPP 240 Query: 235 APTLCDRVQAAGRRVHAIGKIKDIFSGRGIDTVAKGSDAALMEALIAAGQVAEEGSLTFA 294 AP L + VQ AG+ VHAIGKI DIFS +GIDT+ KG DA LM+ L A AEEGSLTFA Sbjct: 241 APILTNWVQDAGQLVHAIGKIGDIFSMQGIDTLKKGDDATLMQYLHDAVAGAEEGSLTFA 300 Query: 295 NFVEFDSLYGHRRDVAGYARALEWFDAQLPRFLATLRPGDLAIFTADHGNDPTWHGTEHT 354 NFVEFDSLYGHRRD++GYA+ALEWFD ++ L LR GDL I TADHGNDP+W GT+HT Sbjct: 301 NFVEFDSLYGHRRDISGYAQALEWFDREIGTLLPRLREGDLLILTADHGNDPSWPGTDHT 360 Query: 355 RERVPVVGYGVGVHEVGIVGFRDVGATIGAHLGVEMFDMGKAML 398 RE+VPV+ G G +G +GF DV AT+ AHL V + G+ L Sbjct: 361 REQVPVLIAGAGAGPLGTIGFVDVAATVAAHLNVPVQGPGRPAL 404 Lambda K H 0.321 0.137 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 576 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 399 Length of database: 406 Length adjustment: 31 Effective length of query: 368 Effective length of database: 375 Effective search space: 138000 Effective search space used: 138000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate GFF1180 PGA1_c11950 (phosphopentomutase DeoB)
to HMM TIGR01696 (deoB: phosphopentomutase (EC 5.4.2.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01696.hmm # target sequence database: /tmp/gapView.16978.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01696 [M=381] Accession: TIGR01696 Description: deoB: phosphopentomutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-120 386.0 0.0 9.7e-120 385.8 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF1180 PGA1_c11950 phosphopentomutase D Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF1180 PGA1_c11950 phosphopentomutase DeoB # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 385.8 0.0 9.7e-120 9.7e-120 1 373 [. 3 394 .. 3 401 .. 0.90 Alignments for each domain: == domain 1 score: 385.8 bits; conditional E-value: 9.7e-120 TIGR01696 1 rvflivldsvGiGeaedaa.....dfkdeGadtlghiaealdk..........lnlpnleklGlgkiee....lag 57 r+fl+v+dsvGiG a+da d+ d Ga+tl hia+a++ l+lpnl++lGlg + ++ lcl|FitnessBrowser__Phaeo:GFF1180 3 RAFLVVMDSVGIGGAPDAGayfngDLPDLGANTLAHIAQACAAgqaeegrsgpLHLPNLDQLGLGAAVAlvsaVPC 78 89***************962222245699*************99********************998775444333 PP TIGR01696 58 vd.aveevlayyaklseassGkdtmtGhweiaGlnilkefkvfs...ngfpeelldkleeragrk.vlgnkpasGt 128 d + + v + ++ ++e+s Gkdt++Ghwe+aGl++ ++ +f+ +fp+ l+ ++ ag + +lgn++asGt lcl|FitnessBrowser__Phaeo:GFF1180 79 PDlGGAGVTGRWGAAREISRGKDTPSGHWELAGLPVPWDWCYFPdqtPAFPDHLVAHVCAAAGTEaILGNCHASGT 154 333568899***********************************76668**************998********** PP TIGR01696 129 vildelGeehmktGklivytsadsvlqiaaheevvpleelyelcekarellkdpkyliGriiarpfvGe.aGnfkr 203 +i+ e G hm++G +i ytsadsv+qiaahee+++l++l lce + l++ ++Gr+iarpf+G f+r lcl|FitnessBrowser__Phaeo:GFF1180 155 AIIAEHGAAHMQSGLPICYTSADSVFQIAAHEETFGLNRLLALCEAVAPYLHQM--KVGRVIARPFIGTpQTGFQR 228 ************************************************999865..69***********5578*** PP TIGR01696 204 tsnrhdyalkpfaktvldklkdekydvisiGkiadiydgeGitkkvrtksnmdgldkvikelkedftg.isfanlv 278 t+nr dya+ p+a+ + + ++d++ v +iGki di++ +Gi ++ +++ + + + + +g ++fan+v lcl|FitnessBrowser__Phaeo:GFF1180 229 TTNRRDYAIMPPAPILTNWVQDAGQLVHAIGKIGDIFSMQGIDTLKK-GDDATLMQYLHDAVAGAEEGsLTFANFV 303 ******************************************87655.456778999999999999988******* PP TIGR01696 279 dfdalyGhrrdkeGyaaaleefdarlpellsklreddlliltadhGndptatGtdhtreyipvlvyspkvkkgqal 354 +fd+lyGhrrd +Gya+ale fd+ + ll +lre dlliltadhGndp ++Gtdhtre +pvl+ + + lcl|FitnessBrowser__Phaeo:GFF1180 304 EFDSLYGHRRDISGYAQALEWFDREIGTLLPRLREGDLLILTADHGNDPSWPGTDHTREQVPVLIAGAGAGPL--- 376 *****************************************************************99765554... PP TIGR01696 355 esaetfadiGatladnfnt 373 + + f d+ at+a ++n+ lcl|FitnessBrowser__Phaeo:GFF1180 377 G-TIGFVDVAATVAAHLNV 394 3.34688888888887776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (381 nodes) Target sequences: 1 (406 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 7.10 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory