Align Phosphopentomutase (EC 5.4.2.7) (characterized)
to candidate GFF1180 PGA1_c11950 phosphopentomutase DeoB
Query= reanno::Dino:3607415 (399 letters) >FitnessBrowser__Phaeo:GFF1180 Length = 406 Score = 517 bits (1331), Expect = e-151 Identities = 262/404 (64%), Positives = 302/404 (74%), Gaps = 6/404 (1%) Query: 1 MTRAFLIVMDSVGCGGAPDAA-----DFGDEGANTLAHIAQACAAGRADAGRSGPLRMPV 55 M RAFL+VMDSVG GGAPDA D D GANTLAHIAQACAAG+A+ GRSGPL +P Sbjct: 1 MPRAFLVVMDSVGIGGAPDAGAYFNGDLPDLGANTLAHIAQACAAGQAEEGRSGPLHLPN 60 Query: 56 LDGLGLGAAIRLASGAETPGLA-ATPTGLWGAATEVSRGKDTPTGHWELAGVPVPWEWTT 114 LD LGLGAA+ L S P L A TG WGAA E+SRGKDTP+GHWELAG+PVPW+W Sbjct: 61 LDQLGLGAAVALVSAVPCPDLGGAGVTGRWGAAREISRGKDTPSGHWELAGLPVPWDWCY 120 Query: 115 FPDTDPAFPPDLLAEMARAAGTEGTLCNTHASGTEVIERFGAEHLRTGWPICYTSVDSVL 174 FPD PAFP L+A + AAGTE L N HASGT +I GA H+++G PICYTS DSV Sbjct: 121 FPDQTPAFPDHLVAHVCAAAGTEAILGNCHASGTAIIAEHGAAHMQSGLPICYTSADSVF 180 Query: 175 QIAAHEEAFGLDRLLDVCETLAPRLHAMKVGRVIARPFLGSEATGFARTQNRRDFAIAPP 234 QIAAHEE FGL+RLL +CE +AP LH MKVGRVIARPF+G+ TGF RT NRRD+AI PP Sbjct: 181 QIAAHEETFGLNRLLALCEAVAPYLHQMKVGRVIARPFIGTPQTGFQRTTNRRDYAIMPP 240 Query: 235 APTLCDRVQAAGRRVHAIGKIKDIFSGRGIDTVAKGSDAALMEALIAAGQVAEEGSLTFA 294 AP L + VQ AG+ VHAIGKI DIFS +GIDT+ KG DA LM+ L A AEEGSLTFA Sbjct: 241 APILTNWVQDAGQLVHAIGKIGDIFSMQGIDTLKKGDDATLMQYLHDAVAGAEEGSLTFA 300 Query: 295 NFVEFDSLYGHRRDVAGYARALEWFDAQLPRFLATLRPGDLAIFTADHGNDPTWHGTEHT 354 NFVEFDSLYGHRRD++GYA+ALEWFD ++ L LR GDL I TADHGNDP+W GT+HT Sbjct: 301 NFVEFDSLYGHRRDISGYAQALEWFDREIGTLLPRLREGDLLILTADHGNDPSWPGTDHT 360 Query: 355 RERVPVVGYGVGVHEVGIVGFRDVGATIGAHLGVEMFDMGKAML 398 RE+VPV+ G G +G +GF DV AT+ AHL V + G+ L Sbjct: 361 REQVPVLIAGAGAGPLGTIGFVDVAATVAAHLNVPVQGPGRPAL 404 Lambda K H 0.321 0.137 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 576 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 399 Length of database: 406 Length adjustment: 31 Effective length of query: 368 Effective length of database: 375 Effective search space: 138000 Effective search space used: 138000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate GFF1180 PGA1_c11950 (phosphopentomutase DeoB)
to HMM TIGR01696 (deoB: phosphopentomutase (EC 5.4.2.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01696.hmm # target sequence database: /tmp/gapView.19401.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01696 [M=381] Accession: TIGR01696 Description: deoB: phosphopentomutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-120 386.0 0.0 9.7e-120 385.8 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF1180 PGA1_c11950 phosphopentomutase D Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF1180 PGA1_c11950 phosphopentomutase DeoB # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 385.8 0.0 9.7e-120 9.7e-120 1 373 [. 3 394 .. 3 401 .. 0.90 Alignments for each domain: == domain 1 score: 385.8 bits; conditional E-value: 9.7e-120 TIGR01696 1 rvflivldsvGiGeaedaa.....dfkdeGadtlghiaealdk..........lnlpnleklGlgkiee....lag 57 r+fl+v+dsvGiG a+da d+ d Ga+tl hia+a++ l+lpnl++lGlg + ++ lcl|FitnessBrowser__Phaeo:GFF1180 3 RAFLVVMDSVGIGGAPDAGayfngDLPDLGANTLAHIAQACAAgqaeegrsgpLHLPNLDQLGLGAAVAlvsaVPC 78 89***************962222245699*************99********************998775444333 PP TIGR01696 58 vd.aveevlayyaklseassGkdtmtGhweiaGlnilkefkvfs...ngfpeelldkleeragrk.vlgnkpasGt 128 d + + v + ++ ++e+s Gkdt++Ghwe+aGl++ ++ +f+ +fp+ l+ ++ ag + +lgn++asGt lcl|FitnessBrowser__Phaeo:GFF1180 79 PDlGGAGVTGRWGAAREISRGKDTPSGHWELAGLPVPWDWCYFPdqtPAFPDHLVAHVCAAAGTEaILGNCHASGT 154 333568899***********************************76668**************998********** PP TIGR01696 129 vildelGeehmktGklivytsadsvlqiaaheevvpleelyelcekarellkdpkyliGriiarpfvGe.aGnfkr 203 +i+ e G hm++G +i ytsadsv+qiaahee+++l++l lce + l++ ++Gr+iarpf+G f+r lcl|FitnessBrowser__Phaeo:GFF1180 155 AIIAEHGAAHMQSGLPICYTSADSVFQIAAHEETFGLNRLLALCEAVAPYLHQM--KVGRVIARPFIGTpQTGFQR 228 ************************************************999865..69***********5578*** PP TIGR01696 204 tsnrhdyalkpfaktvldklkdekydvisiGkiadiydgeGitkkvrtksnmdgldkvikelkedftg.isfanlv 278 t+nr dya+ p+a+ + + ++d++ v +iGki di++ +Gi ++ +++ + + + + +g ++fan+v lcl|FitnessBrowser__Phaeo:GFF1180 229 TTNRRDYAIMPPAPILTNWVQDAGQLVHAIGKIGDIFSMQGIDTLKK-GDDATLMQYLHDAVAGAEEGsLTFANFV 303 ******************************************87655.456778999999999999988******* PP TIGR01696 279 dfdalyGhrrdkeGyaaaleefdarlpellsklreddlliltadhGndptatGtdhtreyipvlvyspkvkkgqal 354 +fd+lyGhrrd +Gya+ale fd+ + ll +lre dlliltadhGndp ++Gtdhtre +pvl+ + + lcl|FitnessBrowser__Phaeo:GFF1180 304 EFDSLYGHRRDISGYAQALEWFDREIGTLLPRLREGDLLILTADHGNDPSWPGTDHTREQVPVLIAGAGAGPL--- 376 *****************************************************************99765554... PP TIGR01696 355 esaetfadiGatladnfnt 373 + + f d+ at+a ++n+ lcl|FitnessBrowser__Phaeo:GFF1180 377 G-TIGFVDVAATVAAHLNV 394 3.34688888888887776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (381 nodes) Target sequences: 1 (406 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.20 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory