GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nupA in Phaeobacter inhibens BS107

Align Purine/cytidine ABC transporter ATP-binding protein, component of General nucleoside uptake porter, NupABC/BmpA (transports all common nucleosides as well as 5-fluorocytidine, inosine, deoxyuridine and xanthosine) (Martinussen et al., 2010) (Most similar to 3.A.1.2.12). NupA is 506aas with two ABC (C) domains. NupB has 8 predicted TMSs, NupC has 9 or 10 predicted TMSs in a 4 + 1 (or 2) + 4 arrangement (characterized)
to candidate GFF385 PGA1_c03960 ribose import ATP-binding protein RbsA

Query= TCDB::A2RKA7
         (506 letters)



>lcl|FitnessBrowser__Phaeo:GFF385 PGA1_c03960 ribose import
           ATP-binding protein RbsA
          Length = 509

 Score =  444 bits (1141), Expect = e-129
 Identities = 232/501 (46%), Positives = 335/501 (66%), Gaps = 9/501 (1%)

Query: 7   IQMIDVTKRFGDFVANDKVNLELKKGEIHALLGENGAGKSTLMNILSGLLEPSEGEVHVK 66
           I++  ++K FG   AN  +++ +  G IH ++GENGAGKSTLM+IL G  +  +GEV + 
Sbjct: 6   IELKGISKAFGPVQANKDISIRVAPGTIHGIIGENGAGKSTLMSILYGFYKADKGEVWIH 65

Query: 67  GKLENIDSPSKAANLGIGMVHQHFMLVDAFTVTENIILGNEVTKGINLDLKTAKKKILEL 126
           GK   I     A + GIGMV QHF LV+ FTV ENIILG E    +   L  A+K + +L
Sbjct: 66  GKRTEIPDSQAAISAGIGMVFQHFKLVENFTVLENIILGAEDGGLLKPSLSKARKSLKDL 125

Query: 127 SERYGLSVEPDALIRDISVGQQQRVEILKTLYRGADILIFDEPTAVLTPAEITELMQIMK 186
           +  Y L+V+PDA I +I VG QQRVEILK LYR ADILI DEPT VLTPAE  +L +I+ 
Sbjct: 126 AAEYELNVDPDARIDEIGVGMQQRVEILKALYRQADILILDEPTGVLTPAEADQLFRILD 185

Query: 187 NLIKEGKSIILITHKLDEIRAVADRITVIRRGKSIDTVELGDKTNQELAELMVGRSVSFI 246
            L  EGK+IILITHKL EI    D ++V+RRG+   TV+  + + + LAELMVGR V   
Sbjct: 186 RLRAEGKTIILITHKLREIMEYTDTVSVMRRGEMTATVKTAETSPEHLAELMVGRKVLLR 245

Query: 247 TEKAAAQPKDVVLEIKDLNIKESRGSLKVKGLSLDVRAGEIVGVAGIDGNGQTELVKAIT 306
            +K  A P   +LEI++L++ +  G  +VK + L VRAGEI+G+AG+ GNGQ+EL++ + 
Sbjct: 246 VDKVPATPGKPILEIENLSVVDEAGVARVKNIDLTVRAGEILGIAGVAGNGQSELMEVLG 305

Query: 307 GLTKVDSGSIKLHNKDI------TNQRPRKITEQSVGHVPEDRHRDGLVLEMTVAENIAL 360
           G+ +   GSI+L+   +      ++ R R+     V HVPEDR R+GL+++    EN+A 
Sbjct: 306 GM-REGQGSIRLNGAPLPLSGAGSDARARRAAH--VAHVPEDRQREGLIMDFHAWENVAF 362

Query: 361 QTYYKPPMSKYGFLDYNKINSHARELMEEFDVRGAGEWVSASSLSGGNQQKAIIAREIDR 420
             ++ P   +   ++   + +     M +FDVR    W++A + SGGNQQK ++AREI+R
Sbjct: 363 GYHHAPEYQRGLLMNNAALRADTEAKMAKFDVRPPDPWLAAKNFSGGNQQKIVVAREIER 422

Query: 421 NPDLLIVSQPTRGLDVGAIEYIHKRLIQARDEGKAVLVISFELDEILNVSDRIAVIHDGQ 480
           NP+LL++ QPTRG+D+GAIE+IHK++++ RD+GKA+L++S EL+EIL+++DR+AV+ DG 
Sbjct: 423 NPELLLIGQPTRGVDIGAIEFIHKQIVELRDQGKAILLVSVELEEILSLADRVAVMFDGM 482

Query: 481 IQGIVSPETTTKQELGILMVG 501
           I G    + T ++ELG+LM G
Sbjct: 483 IMGERPADQTDEKELGLLMAG 503



 Score = 83.2 bits (204), Expect = 2e-20
 Identities = 62/233 (26%), Positives = 108/233 (46%), Gaps = 16/233 (6%)

Query: 276 KGLSLDVRAGEIVGVAGIDGNGQTELVKAITGLTKVDSGSIKLHNKDITNQRPRKITEQS 335
           K +S+ V  G I G+ G +G G++ L+  + G  K D G + +H K       +      
Sbjct: 22  KDISIRVAPGTIHGIIGENGAGKSTLMSILYGFYKADKGEVWIHGKRTEIPDSQAAISAG 81

Query: 336 VGHVPEDRHRDGLVLEMTVAENIALQT----YYKPPMSKYGFLDYNKINSHARELMEEFD 391
           +G V +      LV   TV ENI L        KP +SK             ++L  E++
Sbjct: 82  IGMVFQHFK---LVENFTVLENIILGAEDGGLLKPSLSK--------ARKSLKDLAAEYE 130

Query: 392 VRGAGEWVSASSLSGGNQQKAIIAREIDRNPDLLIVSQPTRGLDVGAIEYIHKRLIQARD 451
           +    +      +  G QQ+  I + + R  D+LI+ +PT  L     + + + L + R 
Sbjct: 131 LNVDPD-ARIDEIGVGMQQRVEILKALYRQADILILDEPTGVLTPAEADQLFRILDRLRA 189

Query: 452 EGKAVLVISFELDEILNVSDRIAVIHDGQIQGIVSPETTTKQELGILMVGGNI 504
           EGK +++I+ +L EI+  +D ++V+  G++   V    T+ + L  LMVG  +
Sbjct: 190 EGKTIILITHKLREIMEYTDTVSVMRRGEMTATVKTAETSPEHLAELMVGRKV 242


Lambda     K      H
   0.315    0.135    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 693
Number of extensions: 31
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 506
Length of database: 509
Length adjustment: 34
Effective length of query: 472
Effective length of database: 475
Effective search space:   224200
Effective search space used:   224200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory