Align ABC transporter for L-Fucose, permease component 1 (characterized)
to candidate GFF1647 PGA1_c16700 binding protein-dependent transport system, inner membrane component
Query= reanno::Smeli:SM_b21104 (298 letters) >FitnessBrowser__Phaeo:GFF1647 Length = 316 Score = 160 bits (406), Expect = 3e-44 Identities = 87/273 (31%), Positives = 148/273 (54%), Gaps = 1/273 (0%) Query: 9 PTLLLLPAFIVLAVFIVLPLIFSLYSSFTPFRLTKPDSLWVFIGFRNYVNVLTNAEFWVA 68 P L L P +++ +++PLI + SF L P + ++GF NY + ++ +FW+A Sbjct: 33 PFLYLSPMILLIGSVMLIPLIVGISYSFQSIELLNPFATG-WVGFENYEKLWSDRKFWIA 91 Query: 69 FGRTVLLLTVALNAEMFLGLGLALLVNKATYGQRALRTAMMFPMMFSPVLVGFQFKFLFN 128 T ++ + FLGLGLA+L+N +G++ + + P L + +LFN Sbjct: 92 LENTFFWTFWSIFFQFFLGLGLAMLLNTQFFGKKLFQALVFLPWAVPTFLSALTWAWLFN 151 Query: 129 DNIGFVNNALQSLGLTDRAIPWLIDGNLALFSIIVAEVWSSTAVFAILILAGLLAMPKDP 188 IG + + L +LG+ L D +LA++ I A +W FAI +LA L ++P + Sbjct: 152 PVIGPIPHWLAALGVLSEPYNILGDPDLAIWGPITANIWFGVPFFAITLLAALQSIPGEL 211 Query: 189 VEAAHVDGCTPWQTFRYVTWPYLMPFAFIAMTIRSLDVARAYDIVKIMTDGGPAKRTELL 248 EAA +DG TPWQ+F +T P+L P I + +R++ +A D++ +MT GGPA T++L Sbjct: 212 YEAAEIDGATPWQSFTKITLPFLAPMIAITVMLRTIWIANFADLIFVMTGGGPANSTQIL 271 Query: 249 WTLIGRTAYGDARMGMANAMAYVAILLSIFFTV 281 T I TA+ G A+ +A +++ + + V Sbjct: 272 STYIFTTAFRKLDFGYASTIAVALLIILLAYAV 304 Lambda K H 0.331 0.142 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 21 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 316 Length adjustment: 27 Effective length of query: 271 Effective length of database: 289 Effective search space: 78319 Effective search space used: 78319 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory