Align ABC transporter for L-Fucose, permease component 1 (characterized)
to candidate GFF726 PGA1_c07410 binding protein dependent transport system permease
Query= reanno::Smeli:SM_b21104 (298 letters) >FitnessBrowser__Phaeo:GFF726 Length = 315 Score = 129 bits (324), Expect = 9e-35 Identities = 90/279 (32%), Positives = 137/279 (49%), Gaps = 10/279 (3%) Query: 8 APTLLLLPAFIVLAVFIVLPLIFSLYSSFTPFR-LTKPDSLWVFIGFRNYVNVLTNAEFW 66 AP L L P I +++ P++ S SF + L P FIG NY ++ + F Sbjct: 32 APWLFLAPGVIFFLFYVIFPILQSFNLSFYRWDGLGDPQ----FIGMENYRELMDDRAFE 87 Query: 67 VAFGRTVLLLTVALNAEMFLGLGLALLVNKATYGQRALRTAMMFPMMFSPVLVGFQFKFL 126 V+ + L + L A + GL +AL +N+ G R ++ FP + S V+VG F + Sbjct: 88 VSLWNNLKWLLLYLLA-IPAGLFIALFLNQTVTGIRLYKSLFFFPFVISQVVVGLVFSWF 146 Query: 127 FNDNIGFVNNALQSLGLTDRAIPWLIDGNLALFSIIVAEVWSSTAVFAILILAGLLAMPK 186 ++ G +N L +GL I L D L + II+A +W TA IL L GL A+ Sbjct: 147 YDPTFGLLNQVLAWVGLGP--INVLGDPTLVTYGIIIAGLWPQTAYCMILYLTGLNAVDP 204 Query: 187 DPVEAAHVDGCTPWQTFRYVTWPYLMPFAFIAMTIRSLDVARAYDIVKIMTDGGPAKRTE 246 + VEAA +DG + YV P L P F+A + + R++D++ IMT+GGP + Sbjct: 205 EQVEAARLDGAKGAKMLWYVIIPQLRPATFVAFVVTIIGALRSFDLISIMTNGGPFGSSR 264 Query: 247 LLWTLIGRTAYGD--ARMGMANAMAYVAILLSIFFTVYF 283 +L + A + RMG A+A V L+ + F YF Sbjct: 265 VLSFYMFEKALSEYGFRMGYGAAIAVVLFLIMLCFIAYF 303 Lambda K H 0.331 0.142 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 277 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 315 Length adjustment: 27 Effective length of query: 271 Effective length of database: 288 Effective search space: 78048 Effective search space used: 78048 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory