Align L-fuculose phosphate aldolase; EC 4.1.2.17; L-fuculose-1-phosphate aldolase (uncharacterized)
to candidate GFF1603 PGA1_c16250 putative L-fuculose phosphate aldolase
Query= curated2:Q8FEF0 (215 letters) >FitnessBrowser__Phaeo:GFF1603 Length = 223 Score = 180 bits (457), Expect = 2e-50 Identities = 96/215 (44%), Positives = 137/215 (63%), Gaps = 5/215 (2%) Query: 2 ERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDG-MLITPTGIPYEKLTESHIVFID- 59 + + L + IID CLEM R G+NQGT+GN+S+R G MLITP+GIPYE ++ IV + Sbjct: 8 DSDTLRQSIIDACLEMNRSGINQGTSGNISLRIAGGEMLITPSGIPYEAMSPDMIVRMPV 67 Query: 60 -GNGKHEEGK-LPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRPIPAIHYMIAA 117 G+ + G+ PSSEW+FH A + +P+ AVVH H V+C A+++ + PIPA HYM+AA Sbjct: 68 VGSPDPQRGQPSPSSEWQFHQALLEDKPEVMAVVHAHPVNCCALAVNHMPIPACHYMVAA 127 Query: 118 AGGNSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIACEANLEKALWLAHEVEVL 177 GG+ +P A YA FGT ELS HV A+ +R+ L+ +HG I L +A+W E+E L Sbjct: 128 FGGHDVPLAEYALFGTTELSAHVVAAMADREGCLMANHGAICTGDTLARAMWRMAELEHL 187 Query: 178 AQLYLTTLAITDPVPVLSDEEIAVVLEKFKTYGLR 212 A Y+ +I P +LS ++ L F +YGL+ Sbjct: 188 AATYIRARSIGTP-RLLSSAQMDEALAAFASYGLK 221 Lambda K H 0.319 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 215 Length of database: 223 Length adjustment: 22 Effective length of query: 193 Effective length of database: 201 Effective search space: 38793 Effective search space used: 38793 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory