Align Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 (characterized)
to candidate GFF2032 PGA1_c20650 triosephosphate isomerase TpiA
Query= SwissProt::Q8L1Z5 (254 letters) >FitnessBrowser__Phaeo:GFF2032 Length = 250 Score = 246 bits (629), Expect = 2e-70 Identities = 131/243 (53%), Positives = 163/243 (67%), Gaps = 4/243 (1%) Query: 6 RPFIAGNWKMNGTGESLGELRAIAAGISSDLGRLFEALICVPATLLSRAFDILGGENILL 65 R AGNWKMNGT +L EL +A S E LIC PATLL RA ++ + + Sbjct: 3 RKLAAGNWKMNGTASALTELGNLAYSCKSAKA---EVLICPPATLLYRAANVCVDSKVSI 59 Query: 66 GGQNCHFDDYGPYTGDISAFMLKEAGASHVIIGHSERRTVYQESDAIVRAKVQAAWRAGL 125 G Q+CH YG +TGD+SA ML +AGA+ VI+GHSERR + E+D VRAK + A AGL Sbjct: 60 GAQDCHDATYGAHTGDLSAEMLHDAGATAVILGHSERRADHDETDETVRAKAKTAIAAGL 119 Query: 126 VALICVGETLEERKSNKVLDVLTRQLEGSLPDGATAENIIIAYEPVWAVGTGNTATSADV 185 A+ICVGETL +R++ K LDV+ QL GSLPD A+ +++AYEPVWA+GTG T + Sbjct: 120 TAIICVGETLNDREAGKTLDVVRAQLAGSLPDDASGTTVVVAYEPVWAIGTGKVPTVEQI 179 Query: 186 AEVHAFIHHKMHSRFGDEGAK-IRLLYGGSVKPSNAFELLSTAHVNGALIGGASLKAIDF 244 AEVH + + RFG E A IRLLYGGSVK SNA E+ + AHV+GAL+GGASLKA DF Sbjct: 180 AEVHNDMRASLVKRFGGETANAIRLLYGGSVKASNAKEIFAVAHVDGALVGGASLKAADF 239 Query: 245 LTI 247 I Sbjct: 240 API 242 Lambda K H 0.320 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 232 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 250 Length adjustment: 24 Effective length of query: 230 Effective length of database: 226 Effective search space: 51980 Effective search space used: 51980 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
Align candidate GFF2032 PGA1_c20650 (triosephosphate isomerase TpiA)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00419.hmm # target sequence database: /tmp/gapView.1907374.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-58 184.3 4.0 1.7e-58 184.1 4.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF2032 PGA1_c20650 triosephosphate isom Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF2032 PGA1_c20650 triosephosphate isomerase TpiA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 184.1 4.0 1.7e-58 1.7e-58 3 227 .. 7 236 .. 5 237 .. 0.91 Alignments for each domain: == domain 1 score: 184.1 bits; conditional E-value: 1.7e-58 TIGR00419 3 iinfKlnesvgkvelevaklaeevaseagvevavappfvdldvvkd.eveseiqvaAqnvdavksGaftGeisAem 77 +n+K+n++ + +e+ +la s a+ ev + pp l ++++ v+s+++++Aq+++ + Ga+tG++sAem lcl|FitnessBrowser__Phaeo:GFF2032 7 AGNWKMNGTASAL-TELGNLAYSCKS-AKAEVLICPPATLLYRAANvCVDSKVSIGAQDCHDATYGAHTGDLSAEM 80 69******99876.689999998755.66788888888877776661577************************** PP TIGR00419 78 lkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleereaartinnvattaaaaA.....le 148 l+d+Ga v++gHsErR+ + e+de + +k ++ + gl++++Cvgetl++rea++t+++v + a + lcl|FitnessBrowser__Phaeo:GFF2032 81 LHDAGATAVILGHSERRADHDETDETVRAKAKTAIAAGLTAIICVGETLNDREAGKTLDVVRAQLAGSLpddasGT 156 *************************************************************999876444555589 PP TIGR00419 149 pdvvAvEPveliGtGkpvskAeaevveksvrdhlkk.vskevaesvrvlyGasvtaaedaelaaqldvdGvLlasa 223 +vvA+EPv++iGtGk+ + + +v++ +r l k e a+ +r+lyG+sv+a++++e +a vdG+L+++a lcl|FitnessBrowser__Phaeo:GFF2032 157 TVVVAYEPVWAIGTGKVPTVEQIAEVHNDMRASLVKrFGGETANAIRLLYGGSVKASNAKEIFAVAHVDGALVGGA 232 99*****************************98877699************************************* PP TIGR00419 224 vlka 227 +lka lcl|FitnessBrowser__Phaeo:GFF2032 233 SLKA 236 ***8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (250 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 20.52 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory