GapMind for catabolism of small carbon sources

 

Aligments for a candidate for BPHYT_RS16930 in Phaeobacter inhibens BS107

Align Arabinose import ATP-binding protein AraG; EC 7.5.2.12 (characterized, see rationale)
to candidate GFF2651 PGA1_c26910 ABC transporter, ATP-binding protein

Query= uniprot:A0A165ZSX8
         (514 letters)



>lcl|FitnessBrowser__Phaeo:GFF2651 PGA1_c26910 ABC transporter,
           ATP-binding protein
          Length = 522

 Score =  256 bits (654), Expect = 1e-72
 Identities = 176/497 (35%), Positives = 259/497 (52%), Gaps = 23/497 (4%)

Query: 16  LRFNGIGKSFPGVQALANISFVAHPGQVHALMGENGAGKSTLLKILGGAYIPSSGDLQIG 75
           LR   I K F  V A  ++SF   PG+V AL+GENGAGK+TL+ IL G Y+  +G +++ 
Sbjct: 16  LRLQNITKRFGSVTANDDVSFDLFPGEVIALLGENGAGKTTLMNILFGQYMADTGGVELF 75

Query: 76  EQTMAFKGTADSIASGVAVIHQELHLVPEMTVAENLFLGHLPARFGLVNRGVLRQQALTL 135
              +       ++  GV ++HQ   L   +TV EN+ LG  P    L+  G+    A   
Sbjct: 76  GAPLPPGAPRAALDGGVGMVHQHFTLADNLTVWENITLGVEP----LLGLGLRAGPAKAR 131

Query: 136 LKGLADE----IDPQEKVGRLSLGQRQLVEIAKALSRGAHVIAFDEPTSSLSAREIDRLM 191
           ++ LA++    +DP  KV RL++G+RQ VEI KAL R A ++  DEPT+ L+ +E D L 
Sbjct: 132 IRALAEQFHLKVDPNAKVSRLTVGERQRVEILKALYRDARILILDEPTAVLTPQESDALF 191

Query: 192 AIIGRLRDEGKVVLYVSHRMEEVFRICNAVTVFKDGRYVRTFENMSELTHDQLVTCMVGR 251
           A +    + G  V+++SH++ EV  I + V V + G+ V   +  ++   D L   MVG 
Sbjct: 192 ATLREAINRGLSVIFISHKLHEVMAISDRVLVLRHGKLVAERQT-ADTDSDALAALMVGA 250

Query: 252 DIQDIYDYRPRERGDVALQVKGLL------GPGLHEPVSFQVHKGEILGLFGLVGAGRTE 305
           D+     +     G   LQ++ +        PGL   VS  +  G+I GL G+ G G+  
Sbjct: 251 DVVPA-KFAANTPGPALLQLRDVTTPSAGASPGLRH-VSLDLAAGQITGLAGVSGNGQAA 308

Query: 306 LLRLLSGLERQREGSLVLHDKELKLRSPRDAIAAGVLLCPEDRKKEGIIPLGSVGENINI 365
           L  L+SGL   + GSL L+       SPR+AI AG+   PEDR K G I    + EN  +
Sbjct: 309 LSDLVSGLITPQSGSLTLNGAAPAGWSPREAITAGIARIPEDRHKTGTIADFDLTENAIL 368

Query: 366 SARPSH-STLGCLLRGDWE--RGNADKQIKSLKVKTPTAGQKIMYLSGGNQQKAILGRWL 422
               +  S  G L   DW   R  A   I    V+ P    +I  LSGGN QK ILGR L
Sbjct: 369 ETYATRFSHRGWL---DWRAARDFAKTVITGYDVRCPGPDTRIRLLSGGNMQKLILGRVL 425

Query: 423 SMPMKVLLLDEPTRGIDIGAKAEIYQIIHNLAADGIAVIVVSSDLMEVMGISDRILVLCE 482
               +++L ++P RG+DIGA   +++ +    A G AV+++S DL E+M +SD I V+ E
Sbjct: 426 EQSPQIILANQPVRGLDIGAVTYVHEQLAKACARGAAVLLISEDLDEIMQLSDVIHVISE 485

Query: 483 GAMRGELSRDQANESNL 499
           G +    +R       L
Sbjct: 486 GRLSPGFARGSKQPEEL 502


Lambda     K      H
   0.320    0.138    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 643
Number of extensions: 37
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 514
Length of database: 522
Length adjustment: 35
Effective length of query: 479
Effective length of database: 487
Effective search space:   233273
Effective search space used:   233273
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory