Align ABC transporter for D-Galactose and D-Glucose, permease component 2 (characterized)
to candidate GFF1916 PGA1_c19480 ABC transporter, inner-membrane protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1896 (281 letters) >FitnessBrowser__Phaeo:GFF1916 Length = 297 Score = 278 bits (711), Expect = 1e-79 Identities = 132/282 (46%), Positives = 190/282 (67%), Gaps = 13/282 (4%) Query: 11 SFSRIAIYATLLLAAAVYLIPLVVMLLTSFKSPEDIRTGNLLSWPTVIDGIGWIKAWDV- 69 S RIAIY L +AAA +L+P+ ++++TS K+ +IR GN+L WP WIKAWD Sbjct: 18 SMRRIAIYVFLSVAAAFFLMPIYIVIVTSLKTMPEIRLGNVLQWPQTWSVDAWIKAWDTA 77 Query: 70 ----------VGGYFWNSVKITVPAVLISTFIGAMNGYVLSMWRFRGSQLFFGLLLFGCF 119 VG FWNS++I +P++++S GA+ GY+L+ W FRG+++FF +LLFG F Sbjct: 78 CTGLQCEGIKVG--FWNSMRILLPSLVVSITAGALCGYILTFWTFRGAEIFFAILLFGAF 135 Query: 120 LPFQTVLLPASFTLGKFGLANTTTGLVLVHVVYGLAFTTLFFRNYYVSIPDALVKAARLD 179 +P+Q ++ P GL T G+VLVH ++GL TL FRNYY ++P + KAAR+D Sbjct: 136 VPYQALIFPMIRIFSATGLYGTLPGIVLVHTIFGLPIMTLIFRNYYSTLPSEIFKAARVD 195 Query: 180 GAGFFTIFLKILLPMSIPIVMVCLIWQFTQIWNDFLFGVVFASGDAQPITVALNNLVNTS 239 GAGFF++F +LLP+S PI++V I Q T IWND+L G++F + P+TV LNN+VN+ Sbjct: 196 GAGFFSVFWYVLLPISTPIIVVAAILQVTGIWNDYLLGLIFGGRENMPMTVQLNNIVNSV 255 Query: 240 TGAKEYNVDMAAAMIAGLPTLLVYIFAGKYFLRGLTSGAVKG 281 G KEYNV+MAA ++ L L VY +G++F+RG+ +GAVKG Sbjct: 256 RGGKEYNVNMAATLLTALVPLTVYFVSGRWFVRGIAAGAVKG 297 Lambda K H 0.329 0.143 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 297 Length adjustment: 26 Effective length of query: 255 Effective length of database: 271 Effective search space: 69105 Effective search space used: 69105 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory