Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate GFF3394 PGA1_c34470 UDP-glucose 4-epimerase ExoB
Query= curated2:Q59745 (327 letters) >FitnessBrowser__Phaeo:GFF3394 Length = 327 Score = 330 bits (847), Expect = 2e-95 Identities = 163/317 (51%), Positives = 215/317 (67%), Gaps = 1/317 (0%) Query: 6 VLVVGGAGYIGSHTCLDLANKGYRPVVFDNFSNGHREFVRWGPAEEGDIRDRARLDEVLA 65 +LV GGAGYIGSH C L G+ PV +DN G ++ V++GP E+GD+ DRARLDEV A Sbjct: 4 ILVTGGAGYIGSHACKALRAAGFTPVTYDNLVTGWQDAVKFGPFEKGDLSDRARLDEVFA 63 Query: 66 KHKPAAILHFAALIEVGESVKDPVSFYENNVIGTLTLLSAAQAAGINAFVFSSTCATYGL 125 K++PAA++HFAAL +VGE++ +P ++ NNV G+LTL+ AA AA FVFSSTCATYG Sbjct: 64 KYQPAAVMHFAALSQVGEAMSEPGRYWANNVGGSLTLIEAAVAADCLDFVFSSTCATYGE 123 Query: 126 PQSVPLDETHRQVPINPYGRTKYIVEQALADYDQYGSLRSVVLRYFNAAGADFEGRIGEW 185 +V LDE+ QVP+N YG +K VE L D+ LRSV+ RYFN AGAD E +GE+ Sbjct: 124 HDNVVLDESTPQVPLNAYGASKRAVEDILRDFGASHGLRSVIFRYFNVAGADPEAEVGEF 183 Query: 186 HQPETHAIPLAIDAALGRRQGFKVFGSDYETRDGTCVRDYIHVLDLADAHVRAVEYLLKG 245 H+PETH +PL +DA G+R +FG+DY+T DGTCVRDY+HV DL DAHV +++L G Sbjct: 184 HRPETHLVPLVLDAIDGKRDALTIFGTDYDTPDGTCVRDYVHVCDLVDAHVLGLKWLKDG 243 Query: 246 GDSVALNLGTGTGTTVKELLGAIEEVSNRPFPVEYIGRREGDSHTLVANNDKARDVLGWV 305 S NLGTGTG +V+E++ E + + P RR GD LV+ + +A +LGW Sbjct: 244 KGSQVFNLGTGTGFSVREVMDKAEATTGKSVPHSIGPRRAGDCTKLVSGSVRAATLLGWE 303 Query: 306 P-QYDLSEIIRSAWDWH 321 P + DL +I AW WH Sbjct: 304 PTRSDLETMIADAWGWH 320 Lambda K H 0.319 0.137 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 327 Length adjustment: 28 Effective length of query: 299 Effective length of database: 299 Effective search space: 89401 Effective search space used: 89401 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate GFF3394 PGA1_c34470 (UDP-glucose 4-epimerase ExoB)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.1944955.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-126 406.4 0.0 4.6e-126 406.1 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF3394 PGA1_c34470 UDP-glucose 4-epimer Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF3394 PGA1_c34470 UDP-glucose 4-epimerase ExoB # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 406.1 0.0 4.6e-126 4.6e-126 2 326 .. 4 321 .. 3 325 .. 0.99 Alignments for each domain: == domain 1 score: 406.1 bits; conditional E-value: 4.6e-126 TIGR01179 2 iLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekitevklvegdladkekleavleeekidaviHf 77 iLvtGgaGyiGsh +++l+++g+ v++Dnl++g ++a+k + + +gdl+d+++l++v+++ ++ av+Hf lcl|FitnessBrowser__Phaeo:GFF3394 4 ILVTGGAGYIGSHACKALRAAGFTPVTYDNLVTGWQDAVKFGP------FEKGDLSDRARLDEVFAKYQPAAVMHF 73 9*****************************************9......*************************** PP TIGR01179 78 aaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEesplnpinpYGrsklmvE 153 aal +vgE+++eP +Y++nnv ++l+L+ea ++a + +++Fss++a+Yge+++v++ E++p+ p n YG+sk++vE lcl|FitnessBrowser__Phaeo:GFF3394 74 AALSQVGEAMSEPGRYWANNVGGSLTLIEAAVAADCLDFVFSSTCATYGEHDNVVLDESTPQVPLNAYGASKRAVE 149 **************************************************************************** PP TIGR01179 154 rilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknathliklvaevavgkrekleifGtdyptkDGtcvRDyi 229 il+d+ + ++l+ vi RYFnvaGAd+e e+Ge ++++thl++lv++++ gkr++l+ifGtdy+t+DGtcvRDy+ lcl|FitnessBrowser__Phaeo:GFF3394 150 DILRDFGAS-HGLRSVIFRYFNVAGADPEAEVGEFHRPETHLVPLVLDAIDGKRDALTIFGTDYDTPDGTCVRDYV 224 ******888.****************************************************************** PP TIGR01179 230 HveDlaeaHlaalealeeggesevynlGagqgfsvkevieavkkvsgkdikveladrRaGDpaslvadaskikrel 305 Hv+Dl +aH+ l++l++g++s+v+nlG+g+gfsv+ev++++++ +gk+++ ++ +rRaGD ++lv+ + ++ + l lcl|FitnessBrowser__Phaeo:GFF3394 225 HVCDLVDAHVLGLKWLKDGKGSQVFNLGTGTGFSVREVMDKAEATTGKSVPHSIGPRRAGDCTKLVSGSVRAATLL 300 **************************************************************************** PP TIGR01179 306 gwkpkyddLeeiiksawdWek 326 gw+p++ dLe++i++aw W+k lcl|FitnessBrowser__Phaeo:GFF3394 301 GWEPTRSDLETMIADAWGWHK 321 *******************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (327 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 27.03 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory