Align Inner membrane ABC transporter permease protein YjfF (characterized)
to candidate GFF2762 PGA1_c28050 putative sugar transport system, permease protein
Query= SwissProt::P37772 (331 letters) >FitnessBrowser__Phaeo:GFF2762 Length = 353 Score = 135 bits (341), Expect = 1e-36 Identities = 93/310 (30%), Positives = 155/310 (50%), Gaps = 17/310 (5%) Query: 8 LMITIGVFVLGYLYCLTQFPGFASTRVICNILTDNAFLGIIAVGMTFVILSGGIDLSVGS 67 +++ + V V G L F FA T ++ + +GI+A + VIL+ GIDLSVG+ Sbjct: 46 IVLVLSVIVFGLLLGSKFFSPFALTLILQQV----GIVGIVACAQSLVILTAGIDLSVGA 101 Query: 68 VIAFTGVFLAKVIGDFGLSPLLAFPLVLVMGCAFGAFMGLLIDALKIPAFIITLAGMF-- 125 ++ + V + + +GL P +A L+ G G G L+ +K+P FI+TL GM+ Sbjct: 102 IMVLSSVVMGQFTFRYGLPPEVAVACGLICGTICGFINGWLVARMKLPPFIVTL-GMWQI 160 Query: 126 -----FLRGVSYLVSEESIPINHPIYDTLSSLAWKIPGGGRLSAMGLL-MLAVVVIGIFL 179 FL + + ++I P+ L KI GG + G++ M+ +VV+ ++ Sbjct: 161 VLASNFLYSANETIRSQTIAAEAPL---LQLFGEKIKIGGAVFTYGVIFMVILVVLLAYV 217 Query: 180 AHRTRFGNQVYAIGGNATSANLMGISTRSTTIRIYMLSTGLATLAGIVFSIYTQAGYALA 239 T +G VYA+G + +A L G+ I +YMLS + AG + + Sbjct: 218 LRHTAWGRHVYAVGDDPEAAELSGVKVTRVLISVYMLSGLICAFAGWAMIGRIGSVSPTS 277 Query: 240 GVGVELDAIASVVIGGTLLSGGVGTVLGTLFGVAIQGLIQTYINFDGTLSSWWTKIAIGI 299 G +++I +VVIGG L GG G++LGT FG I G+ + G + WT + IG+ Sbjct: 278 GQLANIESITAVVIGGISLFGGRGSILGTFFGALIVGVFTLGLRLLGA-DAQWTYLLIGL 336 Query: 300 LLFIFIALQR 309 L+ +A+ + Sbjct: 337 LIIAAVAVDQ 346 Lambda K H 0.329 0.145 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 23 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 353 Length adjustment: 29 Effective length of query: 302 Effective length of database: 324 Effective search space: 97848 Effective search space used: 97848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory